Solanum lycopersicum (tomato): 100736468 Help Entry 100736468         CDS       T02665                                  Symbol ATG8a Name (RefSeq) autophagy-related protein 8a   KO K08341   GABA(A) receptor-associated protein Organism sly  Solanum lycopersicum (tomato) Pathway sly04136   Autophagy - other sly04145   Phagocytosis sly04156   Integrated stress response (ISR) signaling pathway Brite KEGG Orthology (KO) [BR:sly00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     100736468 (ATG8a)    04136 Autophagy - other     100736468 (ATG8a)   09143 Cell growth and death    04156 Integrated stress response (ISR) signaling pathway     100736468 (ATG8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     100736468 (ATG8a)    04121 Ubiquitin system [BR:sly04121]     100736468 (ATG8a)    03029 Mitochondrial biogenesis [BR:sly03029]     100736468 (ATG8a) Membrane trafficking [BR:sly04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     100736468 (ATG8a) Ubiquitin system [BR:sly04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100736468 (ATG8a) Mitochondrial biogenesis [BR:sly03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     100736468 (ATG8a) SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  100736468 NCBI-ProteinID:  NP_001234630 UniProt:  F1JYZ5 A0A3Q7IC58 LinkDB All DBs Position 7:69166715..69177199 Genome browser AA seq 119 aa AA seqDB search MAKSSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQ FVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDEDGFLYMTYSGENTFGSF NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccaaaagctccttcaaattggaacaccctcttgagaggcgacaggctgaagctgct cgtatcagggagaagtaccctgatagaataccggtgattgttgagaaggctgaaagaagt gacatccctgacattgacaagaaaaagtatttggttcccgcggatctgactgttggacaa tttgtgtatgttgttcgcaagaggattaagctcagcgctgagaaggccatttttatcttt gtgaagaatatcctcccccctacagctgccatgatgtctgccatttatgaggaacacaag gatgaggacggcttcctgtacatgacctacagtggcgagaataccttcggatccttctga

DBGET integrated database retrieval system