Solanum lycopersicum (tomato): 101244463 Help Entry 101244463         CDS       T02665                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism sly  Solanum lycopersicum (tomato) Pathway sly04517   IgSF CAM signaling sly04814   Motor proteins Brite KEGG Orthology (KO) [BR:sly00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101244463  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     101244463  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sly03037]     101244463    04812 Cytoskeleton proteins [BR:sly04812]     101244463 Cilium and associated proteins [BR:sly03037]  Motile cilia and associated proteins   Dynein arm    101244463 Cytoskeleton proteins [BR:sly04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101244463 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  101244463 NCBI-ProteinID:  XP_004252346 LinkDB All DBs Position 12:61117987..61118698 Genome browser AA seq 94 aa AA seqDB search MLEGKALIEDTDMPVKMQIQAMSYASQALDLYDVLDCKSIAAHIKKEFDKKYGGGWQCVV GSNFGCFFTHTKGTFIYFTLETLNFLIFKGASSP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgttagaaggcaaagcactgattgaagacacagacatgcctgtaaagatgcagatccaa gctatgtcatacgcttctcaagctcttgatctgtatgatgttttagactgcaaatctatt gctgctcacatcaagaaggaatttgacaagaagtatggaggtggatggcaatgtgtggtg ggatcaaactttgggtgtttctttactcatactaaaggaacatttatctatttcacttta gagactctaaattttctcattttcaaaggagcctcttctccttga

DBGET integrated database retrieval system