Solanum lycopersicum (tomato): 101244463 Help Entry 101244463         CDS       T02665                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism sly  Solanum lycopersicum (tomato) Pathway sly04145   Phagocytosis sly04517   IgSF CAM signaling sly04814   Motor proteins Brite KEGG Orthology (KO) [BR:sly00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101244463  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     101244463   09142 Cell motility    04814 Motor proteins     101244463  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sly03037]     101244463    04812 Cytoskeleton proteins [BR:sly04812]     101244463 Cilium and associated proteins [BR:sly03037]  Motile cilia and associated proteins   Dynein arm    101244463 Cytoskeleton proteins [BR:sly04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101244463 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  101244463 NCBI-ProteinID:  XP_004252346 LinkDB All DBs Position 12:61117987..61118698 Genome browser AA seq 94 aa AA seqDB search MLEGKALIEDTDMPVKMQIQAMSYASQALDLYDVLDCKSIAAHIKKEFDKKYGGGWQCVV GSNFGCFFTHTKGTFIYFTLETLNFLIFKGASSP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgttagaaggcaaagcactgattgaagacacagacatgcctgtaaagatgcagatccaa gctatgtcatacgcttctcaagctcttgatctgtatgatgttttagactgcaaatctatt gctgctcacatcaagaaggaatttgacaagaagtatggaggtggatggcaatgtgtggtg ggatcaaactttgggtgtttctttactcatactaaaggaacatttatctatttcacttta gagactctaaattttctcattttcaaaggagcctcttctccttga

DBGET integrated database retrieval system