Solanum lycopersicum (tomato): 101246287 Help Entry 101246287         CDS       T02665                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sly  Solanum lycopersicum (tomato) Pathway sly03083   Polycomb repressive complex sly04120   Ubiquitin mediated proteolysis sly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101246287    04120 Ubiquitin mediated proteolysis     101246287   09126 Chromosome    03083 Polycomb repressive complex     101246287  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     101246287    04121 Ubiquitin system [BR:sly04121]     101246287    03036 Chromosome and associated proteins [BR:sly03036]     101246287 Membrane trafficking [BR:sly04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101246287 Ubiquitin system [BR:sly04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      101246287    Cul7 complex      101246287 Chromosome and associated proteins [BR:sly03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101246287   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101246287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  101246287 NCBI-ProteinID:  XP_004248652 UniProt:  A0A3Q7IHV2 LinkDB All DBs Position 10:55633695..55651232 Genome browser AA seq 150 aa AA seqDB search MIILRSFNGESFEVDETVALESETIKHMIEDDCANNTIPVPNVTGKILAKVIKYCKRHVE VSKAEDNTAKEDLKTFDAEFVKVDQSTLFNLILAANYLKIKSLIDLTCQTLADMIKGKTP EEIRNLLNIKNDFTPEEEEEIRRENAWAGW NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgatcattttgaggagcttcaacggagagagttttgaggtcgatgagacggtggcgcta gaatcggagacgattaaacatatgattgaggatgactgcgctaacaacaccattcctgta cccaacgttactggcaagatcttagccaaggtcatcaaatattgcaagcgccatgtggag gtttctaaagctgaagataacactgctaaagaggatctgaagacttttgatgctgaattc gtcaaagttgatcagagcacccttttcaatctcatactggctgccaactatttaaaaata aagagcctgattgacctgacatgtcagacacttgctgacatgatcaaagggaagacccct gaagagattcgtaacttacttaacatcaagaacgacttcactcctgaggaagaggaagaa atcaggagggagaatgcttgggcaggctggtga

DBGET integrated database retrieval system