Solanum lycopersicum (tomato): 101246871 Help Entry 101246871         CDS       T02665                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sly  Solanum lycopersicum (tomato) Pathway sly03083   Polycomb repressive complex sly04120   Ubiquitin mediated proteolysis sly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101246871    04120 Ubiquitin mediated proteolysis     101246871   09126 Chromosome    03083 Polycomb repressive complex     101246871  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     101246871    04121 Ubiquitin system [BR:sly04121]     101246871    03036 Chromosome and associated proteins [BR:sly03036]     101246871 Membrane trafficking [BR:sly04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101246871 Ubiquitin system [BR:sly04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      101246871    Cul7 complex      101246871 Chromosome and associated proteins [BR:sly03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101246871   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101246871 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  101246871 NCBI-ProteinID:  XP_004248654 UniProt:  A0A3Q7IIQ2 LinkDB All DBs Position 10:55595008..55597478 Genome browser AA seq 150 aa AA seqDB search MIVLRCSDGETFEVDKAVALESQTIKHMIEDDCADTSIPLPNITSKILALVIEYCKRHLE VAKVEDQTAEEDLKTFDAEFVKVDQSTLFNLILAANYLNIKSLMDLTCQTVAEMIKGKTP EEIRKTFNIKNDFTPEEEEEVRRENAWAFE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgatcgttttgagatgctccgatggagagacctttgaggtagataaggcggtggcattg gaatcacagaccattaagcatatgatagaggacgactgcgctgacaccagcatccctctg cccaacattactagcaagatcttagccctggtcattgaatactgcaagcgccatttggag gttgctaaagttgaggatcagactgctgaagaggatctcaagacttttgatgctgaattc gttaaagttgatcagagcacccttttcaatctcattctagctgccaactatttgaacatc aagagcttgatggatctgacatgtcagacagtagcagagatgatcaagggaaagacgcct gaagagatacgaaagacattcaacatcaagaatgacttcactcctgaagaagaggaagaa gtccggagggagaatgcctgggcattcgagtga

DBGET integrated database retrieval system