Solanum lycopersicum (tomato): 101251031 Help Entry 101251031         CDS       T02665                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sly  Solanum lycopersicum (tomato) Pathway sly04145   Phagosome sly04148   Efferocytosis sly04517   IgSF CAM signaling sly04518   Integrin signaling sly04620   Toll-like receptor signaling pathway sly05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sly00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101251031    04518 Integrin signaling     101251031  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101251031    04148 Efferocytosis     101251031  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101251031  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101251031  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     101251031   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sly04147]     101251031    04031 GTP-binding proteins [BR:sly04031]     101251031 Membrane trafficking [BR:sly04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101251031  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101251031   Macropinocytosis    Ras GTPases     101251031  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101251031 Exosome [BR:sly04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101251031   Exosomal proteins of other body fluids (saliva and urine)    101251031   Exosomal proteins of colorectal cancer cells    101251031   Exosomal proteins of bladder cancer cells    101251031 GTP-binding proteins [BR:sly04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101251031 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  101251031 NCBI-ProteinID:  XP_004229725 LinkDB All DBs Position 1:79299921..79303768 Genome browser AA seq 208 aa AA seqDB search MNSSTSASNNATTTGTKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVN VDGKIVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSFENISKKWVPELRHYA PSVPIVLVGTKLDLREDKQFIRDYPGACTISTEQGEELKKQIGAVAYVECSAKTQQNVKA VFDTAIKVVLQPPKTKKQKRKHKACWIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaatagtagtactagtgctagtaataatgctacaacaactggaacaaagttcatcaaa tgtgttactgttggagatggtgctgttggaaaaacttgtcttctcatctcctacactagc aacactttccccactgattatgtgccaactgtttttgacaatttcagtgccaatgttaat gttgatgggaagattgtgaatcttggcctgtgggatactgctggtcaagaggattataac aggcttaggcctcttagttatcgaggagccgatgtcttcctgcttgctttctctctcata agtaggcctagctttgaaaacatatcaaaaaagtgggttcctgagctaagacattatgcc ccatcagtgcctattgttctagtggggactaaattggatttaagagaggacaagcaattt ataagggactatcctggtgcatgtacaatttcaacagaacagggtgaagaactgaaaaaa caaataggcgcagtggcttatgttgagtgcagtgctaagacgcagcagaatgtgaaggct gtttttgatactgcaatcaaggtagttcttcagcctccaaagaccaaaaaacagaaaagg aaacacaaagcctgctggatactttga

DBGET integrated database retrieval system