Solanum lycopersicum (tomato): 101255333 Help Entry 101255333         CDS       T02665                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism sly  Solanum lycopersicum (tomato) Brite KEGG Orthology (KO) [BR:sly00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:sly03041]     101255333   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sly04052]     101255333 Spliceosome [BR:sly03041]  Complex B   Other components    Complex B specific factors     101255333 Cytokines and neuropeptides [BR:sly04052]  Neuropeptides   Unclassified    101255333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  101255333 NCBI-ProteinID:  XP_010324703 UniProt:  A0A3Q7EJL6 LinkDB All DBs Position 1:78353568..78357207 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVKVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtagtgttgaacgatcgattggggaagaaagtgaaggtgaagtgcaacgaa gatgatacgattggtgatttgaagaagctggttgctgcacagacgggtacacgcgccgat aagatacgtattcagaagtggtataatgtgtacaaagatcatattaccctcaaggactac gaaattcatgatggaatgggacttgaactctactacaactag

DBGET integrated database retrieval system