Solanum lycopersicum (tomato): 101255553 Help Entry 101255553         CDS       T02665                                  Symbol SSK3 Name (RefSeq) SKP1-like protein 11-like   KO K03094   S-phase kinase-associated protein 1 Organism sly  Solanum lycopersicum (tomato) Pathway sly03083   Polycomb repressive complex sly04120   Ubiquitin mediated proteolysis sly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101255553 (SSK3)    04120 Ubiquitin mediated proteolysis     101255553 (SSK3)   09126 Chromosome    03083 Polycomb repressive complex     101255553 (SSK3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     101255553 (SSK3)    04121 Ubiquitin system [BR:sly04121]     101255553 (SSK3)    03036 Chromosome and associated proteins [BR:sly03036]     101255553 (SSK3) Membrane trafficking [BR:sly04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101255553 (SSK3) Ubiquitin system [BR:sly04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      101255553 (SSK3)    Cul7 complex      101255553 (SSK3) Chromosome and associated proteins [BR:sly03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101255553 (SSK3)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101255553 (SSK3) SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  101255553 NCBI-ProteinID:  NP_001288362 UniProt:  K4D584 LinkDB All DBs Position 11:3054406..3054882 Genome browser AA seq 158 aa AA seqDB search MASKKLTLKSSDGDEFEIEESIAVQSGTIKYIIEDGYTLVPLPNVNTQNLILIIEYMKKH GEKTDSNEEEIKEFDKQLLKGKSYQNMFELVTAVKYLDISDLNDLLCQTIADRIKNKSLN AMRQILGVVSDYTPEEEKMHRQEYNWAYEGEDIDESLD NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atggcttcaaaaaaattgaccttgaaatcatcggatggtgatgaatttgagattgaagaa tcgattgcggttcaatctggaacgataaaatatattatcgaggacggttataccctcgtc ccattgcctaacgtgaatactcaaaacctaattttaattatcgagtacatgaagaagcat ggagagaagacggattcaaacgaagaagaaattaaggaatttgataagcaacttttgaag ggtaagagctatcaaaacatgtttgaacttgtaactgcggtaaaatatcttgatattagc gatttgaatgatttgttgtgccagacgatagccgatagaattaagaacaagtctttaaat gctatgcgtcagatattgggtgtggtgagtgattatacgccggaggaagaaaaaatgcat cgtcaagaatataattgggcttatgaaggagaagacattgatgaatctcttgattag

DBGET integrated database retrieval system