Solanum lycopersicum (tomato): 101255630 Help Entry 101255630         CDS       T02665                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism sly  Solanum lycopersicum (tomato) Pathway sly03030   DNA replication sly03410   Base excision repair sly03420   Nucleotide excision repair sly03430   Mismatch repair sly03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sly00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101255630    03410 Base excision repair     101255630    03420 Nucleotide excision repair     101255630    03430 Mismatch repair     101255630    03440 Homologous recombination     101255630  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sly03032]     101255630    03400 DNA repair and recombination proteins [BR:sly03400]     101255630 DNA replication proteins [BR:sly03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     101255630 DNA repair and recombination proteins [BR:sly03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       101255630    MMR (mismatch excision repair)     DNA polymerase delta complex      101255630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  101255630 NCBI-ProteinID:  XP_004247827 UniProt:  A0A3Q7I880 LinkDB All DBs Position 9:68211094..68213585 Genome browser AA seq 120 aa AA seqDB search MASKSSMKGFYKQQKKSGGITKPSKSKSTKPKNAAAIGSNVTQPSALISHGSLDLKDNYD QNEEVLRQFDMNMVYGPCLGMNRLDRWERAKKLGMNPPADVERLLRSNKVRNECLWDGRV NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgaaatcgagcatgaaaggtttctacaagcagcagaagaagagtggaggcatc acaaaaccatcgaaatcaaaatccaccaaaccaaaaaatgctgcagctattggttctaat gttactcagccttcagcactcatctcccatggctctcttgatttgaaagataattatgat cagaatgaggaagtgttgaggcaattcgacatgaatatggtttatgggccatgccttgga atgaacagactggacaggtgggagcgtgccaagaaacttggaatgaaccctccagcagac gtggagcgccttttaaggtctaacaaagttcgcaatgagtgcctgtgggatggtcgcgtt tag

DBGET integrated database retrieval system