Solanum lycopersicum (tomato): 101256315 Help Entry 101256315         CDS       T02665                                  Symbol CaM1 Name (RefSeq) calmodulin 1   KO K02183   calmodulin Organism sly  Solanum lycopersicum (tomato) Pathway sly04016   MAPK signaling pathway - plant sly04070   Phosphatidylinositol signaling system sly04075   Plant hormone signal transduction sly04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:sly00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     101256315 (CaM1)    04070 Phosphatidylinositol signaling system     101256315 (CaM1)    04075 Plant hormone signal transduction     101256315 (CaM1)  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     101256315 (CaM1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sly01009]     101256315 (CaM1)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     101256315 (CaM1)    03036 Chromosome and associated proteins [BR:sly03036]     101256315 (CaM1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sly04147]     101256315 (CaM1) Protein phosphatases and associated proteins [BR:sly01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101256315 (CaM1) Membrane trafficking [BR:sly04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101256315 (CaM1) Chromosome and associated proteins [BR:sly03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101256315 (CaM1) Exosome [BR:sly04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101256315 (CaM1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C PhageMin_Tail MecA_N DUF6279 Motif Other DBs NCBI-GeneID:  101256315 NCBI-ProteinID:  NP_001311414 UniProt:  A0A3Q7E957 LinkDB All DBs Position 1:complement(3333198..3336305) Genome browser AA seq 149 aa AA seqDB search MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctcaccgaagatcagatctctgagttcaaggaagctttcagtcttttt gacaaagacggagatggttgtatcacaactaaggaacttggaacagtaatgcggtcattg gggcagaacccaaccgaggctgagcttcaagacatgatcaatgaagttgatgctgatgga aatgggaccattgatttcccagagttccttaacctgatggctcgcaagatgaaggacact gattctgaggaggagctcaaggaagctttcagagtgtttgacaaggatcagaatggattc atctccgcagctgagcttcgtcatgtgatgacaaacctaggcgaaaagcttactgatgaa gaggttgatgagatgattcgtgaagctgatgtggatggtgatgggcagatcaactacgac gagttcgtcaaggttatgatggccaagtga

DBGET integrated database retrieval system