Solanum lycopersicum (tomato): 101259616 Help Entry 101259616         CDS       T02665                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism sly  Solanum lycopersicum (tomato) Pathway sly04136   Autophagy - other Brite KEGG Orthology (KO) [BR:sly00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     101259616  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     101259616    04121 Ubiquitin system [BR:sly04121]     101259616    03029 Mitochondrial biogenesis [BR:sly03029]     101259616 Membrane trafficking [BR:sly04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     101259616 Ubiquitin system [BR:sly04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    101259616 Mitochondrial biogenesis [BR:sly03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     101259616 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 Motif Other DBs NCBI-GeneID:  101259616 NCBI-ProteinID:  XP_004252395 UniProt:  A0A3Q7JAF4 LinkDB All DBs Position 12:62804343..62811323 Genome browser AA seq 90 aa AA seqDB search MAADSRKVIVHLRATGDAPILKQAKFKIAGTDKFIKVIDFLRRQLHRETLFVYVNSAFSP NPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggctgccgattctcgaaaagtgattgttcatttaagagccactggcgatgctccgatt cttaaacaagcgaaattcaagattgcaggtactgacaaattcatcaaagtaatagatttt ttgcgccgtcaactccatagggagacattgtttgtgtatgtcaacagcgccttctcacca aatccagatgagttggtaattgatctatacaataactttggttttgatggtaagttggtg gtcaattatgcatgctccatggcgtggggctga

DBGET integrated database retrieval system