Solanum lycopersicum (tomato): 101262116 Help Entry 101262116         CDS       T02665                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism sly  Solanum lycopersicum (tomato) Pathway sly03030   DNA replication sly03410   Base excision repair sly03420   Nucleotide excision repair sly03430   Mismatch repair sly03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sly00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101262116    03410 Base excision repair     101262116    03420 Nucleotide excision repair     101262116    03430 Mismatch repair     101262116    03440 Homologous recombination     101262116  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sly03032]     101262116    03400 DNA repair and recombination proteins [BR:sly03400]     101262116 DNA replication proteins [BR:sly03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     101262116 DNA repair and recombination proteins [BR:sly03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       101262116    MMR (mismatch excision repair)     DNA polymerase delta complex      101262116 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  101262116 NCBI-ProteinID:  XP_004239870 UniProt:  A0A3Q7HGD5 LinkDB All DBs Position 5:66856719..66858715 Genome browser AA seq 130 aa AA seqDB search MASRSDMKGFYKQTKKNGGIAKPTHSKSSLVATTTNKSVTPKLAPARGSNITRSPALISH GSPDLQADGYDENEELLRQFDTNMTYGPCLGLSRLDRWERAKSFGLNPPTDVEPILRSKV RNECLWDGMV NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgagatcagatatgaagggattctacaagcaaacgaagaaaaatggcggaatc gcaaagccaacacattcaaaatcatcattggttgctactactacaaacaagtcggtaact ccaaagctagcacctgctcgcggctcgaacatcacccggtctccggcgctcatctctcat ggatctcctgatctgcaagctgatggttatgatgagaatgaggagttattaaggcagttt gacacgaatatgacgtatggaccatgtcttggattgagcagacttgacagatgggagcgt gctaagagttttggtttaaaccctcctacagatgttgagcccatcttgagatctaaggtt cgtaacgaatgcctgtgggatggaatggtttaa

DBGET integrated database retrieval system