Solanum lycopersicum (tomato): 101265779 Help Entry 101265779         CDS       T02665                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sly  Solanum lycopersicum (tomato) Pathway sly04145   Phagosome sly04148   Efferocytosis sly04620   Toll-like receptor signaling pathway sly05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sly00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101265779    04148 Efferocytosis     101265779  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101265779  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101265779  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     101265779   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sly04147]     101265779    04031 GTP-binding proteins [BR:sly04031]     101265779 Membrane trafficking [BR:sly04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     101265779  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101265779   Macropinocytosis    Ras GTPases     101265779  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     101265779 Exosome [BR:sly04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101265779   Exosomal proteins of other body fluids (saliva and urine)    101265779   Exosomal proteins of colorectal cancer cells    101265779   Exosomal proteins of bladder cancer cells    101265779 GTP-binding proteins [BR:sly04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     101265779 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  101265779 NCBI-ProteinID:  XP_004231040 UniProt:  A0A3Q7EW11 LinkDB All DBs Position 1:93890196..93895507 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPLSTAQGEELRKSIGAAAYIECSAKTQQNIKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggtttataaagtgtgttaccgtgggcgatggagctgtgggtaaaact tgtcttctcatttcgtataccagcaacacttttcccactgattatgtcccaactgtattt gacaattttagtgcaaatgtggttgtcgatgggagcactgttaatctggggctctgggat actgcaggtcaggaggattacaatagattaagacctttgagctatcgtggggctgatgta tttatactggcattttctctcattagcaaggcgagctatgaaaatgtctccaaaaagtgg attcctgaattgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gatctccgagaggataagcaattctttgtggaccatccaggtgctgttccacttagcact gctcagggtgaggagctgagaaagtcgattggtgctgctgcttacattgaatgtagtgca aaaactcaacagaacattaaggctgtttttgatgcggccattaaggtggtcctacaacca cccaagcaaaagaagaagaagaagagaaagggtcagaaagcctgctctatcttgtga

DBGET integrated database retrieval system