Solanum lycopersicum (tomato): 104645763 Help Entry 104645763         CDS       T02665                                  Name (RefSeq) ROP GTPases family protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sly  Solanum lycopersicum (tomato) Pathway sly04145   Phagosome sly04148   Efferocytosis sly04620   Toll-like receptor signaling pathway sly05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sly00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104645763    04148 Efferocytosis     104645763  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104645763  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     104645763  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     104645763   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sly04147]     104645763    04031 GTP-binding proteins [BR:sly04031]     104645763 Membrane trafficking [BR:sly04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     104645763  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     104645763   Macropinocytosis    Ras GTPases     104645763  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     104645763 Exosome [BR:sly04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104645763   Exosomal proteins of other body fluids (saliva and urine)    104645763   Exosomal proteins of colorectal cancer cells    104645763   Exosomal proteins of bladder cancer cells    104645763 GTP-binding proteins [BR:sly04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     104645763 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 B12-binding Motif Other DBs NCBI-GeneID:  104645763 NCBI-ProteinID:  NP_001315263 LinkDB All DBs Position 2:complement(63151129..63154483) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIVLVGTKL DLRDDKQFFVDHPGAVPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKGKSQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcaaggtttatcaaatgtgttaccgtcggcgatggtgccgttggaaagacg tgtctcttgatttcttacaccagcaataccttccccacggattatgtgcccaccgtgttc gacaatttcagtgcaaatgtggtcgtcaatgggagcactgtcaacctagggttgtgggat actgctggacaggaggattacaataggttaagacctctgagttaccgtggagctgatgtt ttcattttggcattctctctcattagtaaagccagctatgaaaacgttgccaagaagtgg attcctgaattgaagcattatgcccccggtgttccaatagtgcttgttggaacaaaacta gatcttcgggatgataagcaattcttcgtagaccatcctggtgctgtgccaattaccact gctcagggtgaagagctgaggaaaacaattggtgcacctgcttacattgaatgtagttca aaaacacagcagaacgtgaaagcagtctttgatgccgctatcaaggtcgtgctccagcca cccaagcagaagaaaaagaaggggaagtcccaaaaggcatgttctattttgtga

DBGET integrated database retrieval system