Solanum lycopersicum (tomato): 543984 Help Entry 543984            CDS       T02665                                  Symbol CaM6 Name (RefSeq) calmodulin   KO K02183   calmodulin Organism sly  Solanum lycopersicum (tomato) Pathway sly04016   MAPK signaling pathway - plant sly04070   Phosphatidylinositol signaling system sly04075   Plant hormone signal transduction sly04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:sly00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     543984 (CaM6)    04070 Phosphatidylinositol signaling system     543984 (CaM6)    04075 Plant hormone signal transduction     543984 (CaM6)  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     543984 (CaM6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sly01009]     543984 (CaM6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     543984 (CaM6)    03036 Chromosome and associated proteins [BR:sly03036]     543984 (CaM6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sly04147]     543984 (CaM6) Protein phosphatases and associated proteins [BR:sly01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      543984 (CaM6) Membrane trafficking [BR:sly04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     543984 (CaM6) Chromosome and associated proteins [BR:sly03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      543984 (CaM6) Exosome [BR:sly04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    543984 (CaM6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EF-hand_FSTL1 EH SPARC_Ca_bdg EF_EFCAB10_C SAPC2_N EF-hand_11 UPF0154 DUF5580_M EF-hand_EFHB_C Dockerin_1 Caleosin EF-hand_STIM1 EFhand_Ca_insen FCaBP_EF-hand SPEF2_C SurA_N_3 MotA_activ DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  543984 NCBI-ProteinID:  NP_001234786 UniProt:  P27161 LinkDB All DBs Position 3:57212610..57215436 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagagcagctgacggaggagcagatcgctgagttcaaggaagcttttagccttttc gacaaggatggcgatggctgtattactaccaaggagttgggaacagtgatgagatcactt ggtcagaatcccactgaagctgaactacaggatatgatcagtgaagttgatgctgatcag aatggaaccattgattttccagagttcttgaatctgatggcacggaagatgaaggacact gattctgaggaagaactcaaagaggcttttaaggtttttgataaagatcagaatggcttt atttctgcagctgagcttcgtcatgtaatgacaaaccttggagagaagctgactgatgaa gaggtggatgagatgatccgagaggcagatattgatggtgatggacaagttaattatgag gagtttgtccgtatgatgcttgccaagtga

DBGET integrated database retrieval system