KEGG   Streptomyces avermitilis: SAVERM_2995
Entry
SAVERM_2995       CDS       T00126                                 

Symbol
ptlD
Name
(GenBank) putative dioxygenase
  KO
K18057  pentalenolactone F synthase [EC:1.14.11.36]
Organism
sma  Streptomyces avermitilis
Pathway
sma00999  Biosynthesis of various secondary metabolites - part 1
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    SAVERM_2995 (ptlD)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.36  pentalenolactone F synthase
     SAVERM_2995 (ptlD)
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: BAC70706
NITE: SAV2995
UniProt: Q82IY7
LinkDB
Position
3751962..3752882
AA seq 306 aa
MSRAMDITRIPGSAIGAVVAGADFSGTIDDTQVEEIWQALDQHLVLVFRGHKDPSNDDLL
MFARRFGHVPKTGLTTGASPDHNEILLISNILDENGQKIGVGNAEWMDWHTDYSFRPRVS
RIGFLAAVELPPSGGGQTLFTDMYTAYESLPDDLRQRLHSYRARHSLRSGYEDVIEEEYQ
GEVSIEGPTAKPFVAPEDGTATVHQLIARNPRTGRRAVYANPLNTKRILELDVTSSKEVL
QQLFAKPGEPELTYAHEWLPGDIVMWDQLGTVHAKRAFDPTERRLLRKVVTIFDDPAEPW
HPEDAA
NT seq 921 nt   +upstreamnt  +downstreamnt
gtgtcaagagcaatggacattacgcggatacctggttcggcgatcggcgcggtcgtggcc
ggcgccgacttttcaggcaccatcgacgacacgcaggtcgaagagatctggcaggccctc
gaccagcacctcgtgctggttttccgcgggcacaaggatccctcgaacgacgacctcctc
atgttcgcccggcgcttcgggcacgtaccgaagaccggcctgacgaccggtgccagcccg
gatcacaacgagatcctcctcatctccaacatcctcgacgagaacgggcagaagataggc
gtcggcaacgcggagtggatggactggcacacggactactccttccgcccgagggtgtcc
cgcatcggcttcctggcggcggtcgagctaccgccgtcgggcggcggccagacgctgttc
accgacatgtacacggcctacgaatccctcccggacgacctccggcagcgcctgcactcc
taccgggccaggcattcgctccggtccggctacgaggacgtcatcgaggaggagtaccag
ggcgaggtctccatcgaagggccgaccgcgaaaccgttcgtggcccccgaggacggtacg
gcgacggtccatcagctgatcgccaggaacccgcggaccggccgccgcgcggtgtacgcc
aacccgctcaacaccaaacgcatcctcgaactggacgtcacctccagcaaggaggtgctc
cagcagctgttcgccaagcccggtgagccggaactgacctacgcccacgagtggctcccc
ggtgacatcgtcatgtgggaccagttggggaccgtccacgccaaacgggctttcgatccg
accgagcgccggctcctgcgcaaggtcgtcacgatcttcgacgacccggcggagccgtgg
cacccggaggacgcggcgtga

DBGET integrated database retrieval system