KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_4617
Entry
SMDB11_4617       CDS       T03985                                 
Name
(GenBank) putative permease
  KO
K11720  lipopolysaccharide export system permease protein
Organism
smac  Serratia marcescens subsp. marcescens Db11
Pathway
smac02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:smac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SMDB11_4617
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smac02000]
    SMDB11_4617
Transporters [BR:smac02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    SMDB11_4617
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: CDG15179
UniProt: A0ABC9IR75
LinkDB
Position
4972000..4973070
AA seq 356 aa
MFGVLDRYIGKTIFNTIIMTLFMLVSLSGIIKFVDQLRKVGQGEYTALSAGMYTLLSVPK
DIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRLQIAGSVMKTAIPLVLLTMAIGE
WVAPQGEQMARNYRAQQMYGGSLLSTKSGLWAKDGNDFIYIERVSGDKELSGVNIYHFND
QRRLETVRYAATASFENGLWQLSQVDTSDLTNPKQVTGTQTLTGEWKTNLTPDKLGVVAL
DPDSLSISGLHNYVKYLKQSGQESNRYQLNMWSKIFSPLSVAVMMLMALSFIFGPLRSVP
MGIRVVTGISFGFLFYVLDQIFGPLSMVYSMPPVLGALLPSMLFLLISVYMLLKRK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgtttggcgtattagaccggtatatcggcaaaacgattttcaacaccatcatcatgacg
ctgttcatgctggtgtcgctgtccggcatcatcaagttcgtcgatcagctgcgcaaggtc
ggccagggcgaatacaccgcgctgagcgccggcatgtacaccctgctgagcgtgccgaaa
gacatcgagatcttcttcccgatggcggcgctgcttggcgcgctgctcggcctgggccaa
ctggcgacgcgcagcgaactggtggtgatgcaggcttccggctttacccgcctgcagatc
gccggctcggtgatgaaaaccgccattccgctggtgctgctgaccatggcgatcggcgag
tgggtagcgccgcagggcgagcagatggcgcgcaactaccgcgcccagcagatgtacggc
ggctcgctgctctccaccaagagcgggctgtgggcgaaggacggcaacgacttcatctac
atcgagcgcgtctccggcgacaaagaactctccggcgtgaacatctaccacttcaacgat
cagcgtcgcctggaaacggtgcgctatgccgctaccgccagcttcgagaacggcctgtgg
cagctttcgcaggtggacacctcggatctgaccaacccgaaacaggtgaccggcacccag
acgctgaccggcgaatggaaaactaacctaaccccggacaagctgggcgtggtggcgctg
gatccggattcgctctccatcagcgggctgcacaactacgtgaagtacctgaagcagagc
ggccaggaatccaaccgttaccagctcaacatgtggagcaaaatcttctcgccgctgtcg
gtggcggtgatgatgctgatggcgctgtcgttcatcttcggcccgctgcgcagcgtgccg
atgggcatccgcgtggtgaccggcatcagcttcggcttcctgttctacgtgctggatcag
atcttcggcccgctgagcatggtctacagcatgccgccggtgctgggcgcgctgctgccg
agcatgctgttcctgctgatcagcgtgtatatgctgctcaaacgcaagtag

DBGET integrated database retrieval system