Stieleria magnilauensis: TBK1r_11560
Help
Entry
TBK1r_11560 CDS
T10880
Symbol
fadB
Name
(GenBank) Fatty acid oxidation complex subunit alpha
KO
K01825
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:
1.1.1.35
4.2.1.17
5.1.2.3
5.3.3.8
]
Organism
smae Stieleria magnilauensis
Pathway
smae00071
Fatty acid degradation
smae00280
Valine, leucine and isoleucine degradation
smae00310
Lysine degradation
smae00362
Benzoate degradation
smae00380
Tryptophan metabolism
smae00410
beta-Alanine metabolism
smae00640
Propanoate metabolism
smae00650
Butanoate metabolism
smae00907
Pinene, camphor and geraniol degradation
smae00930
Caprolactam degradation
smae01100
Metabolic pathways
smae01110
Biosynthesis of secondary metabolites
smae01120
Microbial metabolism in diverse environments
smae01200
Carbon metabolism
smae01212
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:
smae00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00640 Propanoate metabolism
TBK1r_11560 (fadB)
00650 Butanoate metabolism
TBK1r_11560 (fadB)
09103 Lipid metabolism
00071 Fatty acid degradation
TBK1r_11560 (fadB)
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
TBK1r_11560 (fadB)
00310 Lysine degradation
TBK1r_11560 (fadB)
00380 Tryptophan metabolism
TBK1r_11560 (fadB)
09106 Metabolism of other amino acids
00410 beta-Alanine metabolism
TBK1r_11560 (fadB)
09109 Metabolism of terpenoids and polyketides
00907 Pinene, camphor and geraniol degradation
TBK1r_11560 (fadB)
09111 Xenobiotics biodegradation and metabolism
00362 Benzoate degradation
TBK1r_11560 (fadB)
00930 Caprolactam degradation
TBK1r_11560 (fadB)
Enzymes [BR:
smae01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.35 3-hydroxyacyl-CoA dehydrogenase
TBK1r_11560 (fadB)
4. Lyases
4.2 Carbon-oxygen lyases
4.2.1 Hydro-lyases
4.2.1.17 enoyl-CoA hydratase
TBK1r_11560 (fadB)
5. Isomerases
5.1 Racemases and epimerases
5.1.2 Acting on hydroxy acids and derivatives
5.1.2.3 3-hydroxybutyryl-CoA epimerase
TBK1r_11560 (fadB)
5.3 Intramolecular oxidoreductases
5.3.3 Transposing C=C bonds
5.3.3.8 Delta3-Delta2-enoyl-CoA isomerase
TBK1r_11560 (fadB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
3HCDH_N
3HCDH
Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID:
QDV82229
UniProt:
A0ABX5XJQ4
LinkDB
All DBs
Position
1503797..1504972
Genome browser
AA seq
391 aa
AA seq
DB search
MTPDSPQWPHDLPRVLLIGAGVVGRAIADAHAVRNVTFCLADQSAEAIRAAAIAFDEAGL
ATRECSLPAGSLHAITVGDPNSSDETNAPIVIESIVERSDAKQDVFEMLQNDLGESAVLC
SNTSTLLIDEIAGQRLRSAGRVCGMHFFMPVHARAAVEVVTGKRSDDDAIQAVVDHAARL
GKRAIRCQDGPGFIVNRMLSPYLNQALLLLCRGATERQIERAALAYGMPMSPLELIDWIG
APTMYHAGKAFTSAFPQRIDPSPMVPALLKRKRLGRGSGGGLFDYDRGRRSEQLSAPAQE
LIETYRTDRREFSDGEVLLLLTIPMWIEANCLLKEGIADSMDTVDLAMAGGLGFTSDANW
SEFFAELGTDQIDSAISRWQAEFKSMRNQVA
NT seq
1176 nt
NT seq
+upstream
nt +downstream
nt
atgacacccgattccccgcagtggccgcacgacttgccccgcgttttgttgatcggagcg
ggtgtggtcggacgagcgatcgccgatgcccatgcggtacgcaacgttacgttctgcctg
gcagaccaaagtgctgaggcgatccgagccgcagcgattgcctttgacgaagcgggactt
gcgacgcgtgagtgttcgctgccagccggatcgctgcacgccatcacggtcggcgacccg
aattcgagtgatgagacgaatgcgccgatcgtgatcgaatcgatcgtcgaacgcagtgat
gcgaaacaagacgtgtttgaaatgctgcaaaacgacctgggggaatcggcggtgctctgc
agcaacacgtccaccctgttgatcgacgagatcgccggccagcggttacgttcggccggc
cgggtctgtggcatgcactttttcatgcccgtccatgcccgggcggcggtcgaagtcgtg
acgggaaaacgcagcgacgacgatgcgatccaagcggtcgtggatcacgcggcgcggctg
ggcaagcgcgcgatacggtgccaggacggtcccggattcatcgtcaaccggatgctttcg
ccctatctgaaccaagcattgttgctgctgtgccgtggtgcgaccgagcgccagatcgag
cgagcggcgttggcctacggcatgccgatgtccccactggagttgatcgactggatcggg
gcgcccacgatgtaccatgcgggcaaagcgttcaccagcgcgttcccgcagcggatcgat
ccgtcgcccatggtcccggctttgctcaaacgcaaacgactcggacgcggatccggtggc
ggattgtttgactacgaccgcggcaggcgcagtgagcagttgtccgccccggcacaagag
ctgattgaaacctatcgcaccgaccgccgcgagttcagcgacggagaggtgttgctgttg
ttgacgattccgatgtggattgaagcgaactgcttgctgaaagaaggcatcgctgattcg
atggacaccgtggatttggcgatggcaggcgggctgggattcaccagcgatgcaaactgg
tccgaatttttcgccgaactcggcaccgaccaaatcgacagcgccatcagccgatggcaa
gccgagttcaaatccatgcgaaaccaagtggcgtaa
DBGET
integrated database retrieval system