KEGG   Stieleria magnilauensis: TBK1r_11560
Entry
TBK1r_11560       CDS       T10880                                 
Symbol
fadB
Name
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
smae  Stieleria magnilauensis
Pathway
smae00071  Fatty acid degradation
smae00280  Valine, leucine and isoleucine degradation
smae00310  Lysine degradation
smae00362  Benzoate degradation
smae00380  Tryptophan metabolism
smae00410  beta-Alanine metabolism
smae00640  Propanoate metabolism
smae00650  Butanoate metabolism
smae00907  Pinene, camphor and geraniol degradation
smae00930  Caprolactam degradation
smae01100  Metabolic pathways
smae01110  Biosynthesis of secondary metabolites
smae01120  Microbial metabolism in diverse environments
smae01200  Carbon metabolism
smae01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TBK1r_11560 (fadB)
   00650 Butanoate metabolism
    TBK1r_11560 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TBK1r_11560 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBK1r_11560 (fadB)
   00310 Lysine degradation
    TBK1r_11560 (fadB)
   00380 Tryptophan metabolism
    TBK1r_11560 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBK1r_11560 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00907 Pinene, camphor and geraniol degradation
    TBK1r_11560 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBK1r_11560 (fadB)
   00930 Caprolactam degradation
    TBK1r_11560 (fadB)
Enzymes [BR:smae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     TBK1r_11560 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TBK1r_11560 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     TBK1r_11560 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     TBK1r_11560 (fadB)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: QDV82229
UniProt: A0ABX5XJQ4
LinkDB
Position
1503797..1504972
AA seq 391 aa
MTPDSPQWPHDLPRVLLIGAGVVGRAIADAHAVRNVTFCLADQSAEAIRAAAIAFDEAGL
ATRECSLPAGSLHAITVGDPNSSDETNAPIVIESIVERSDAKQDVFEMLQNDLGESAVLC
SNTSTLLIDEIAGQRLRSAGRVCGMHFFMPVHARAAVEVVTGKRSDDDAIQAVVDHAARL
GKRAIRCQDGPGFIVNRMLSPYLNQALLLLCRGATERQIERAALAYGMPMSPLELIDWIG
APTMYHAGKAFTSAFPQRIDPSPMVPALLKRKRLGRGSGGGLFDYDRGRRSEQLSAPAQE
LIETYRTDRREFSDGEVLLLLTIPMWIEANCLLKEGIADSMDTVDLAMAGGLGFTSDANW
SEFFAELGTDQIDSAISRWQAEFKSMRNQVA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgacacccgattccccgcagtggccgcacgacttgccccgcgttttgttgatcggagcg
ggtgtggtcggacgagcgatcgccgatgcccatgcggtacgcaacgttacgttctgcctg
gcagaccaaagtgctgaggcgatccgagccgcagcgattgcctttgacgaagcgggactt
gcgacgcgtgagtgttcgctgccagccggatcgctgcacgccatcacggtcggcgacccg
aattcgagtgatgagacgaatgcgccgatcgtgatcgaatcgatcgtcgaacgcagtgat
gcgaaacaagacgtgtttgaaatgctgcaaaacgacctgggggaatcggcggtgctctgc
agcaacacgtccaccctgttgatcgacgagatcgccggccagcggttacgttcggccggc
cgggtctgtggcatgcactttttcatgcccgtccatgcccgggcggcggtcgaagtcgtg
acgggaaaacgcagcgacgacgatgcgatccaagcggtcgtggatcacgcggcgcggctg
ggcaagcgcgcgatacggtgccaggacggtcccggattcatcgtcaaccggatgctttcg
ccctatctgaaccaagcattgttgctgctgtgccgtggtgcgaccgagcgccagatcgag
cgagcggcgttggcctacggcatgccgatgtccccactggagttgatcgactggatcggg
gcgcccacgatgtaccatgcgggcaaagcgttcaccagcgcgttcccgcagcggatcgat
ccgtcgcccatggtcccggctttgctcaaacgcaaacgactcggacgcggatccggtggc
ggattgtttgactacgaccgcggcaggcgcagtgagcagttgtccgccccggcacaagag
ctgattgaaacctatcgcaccgaccgccgcgagttcagcgacggagaggtgttgctgttg
ttgacgattccgatgtggattgaagcgaactgcttgctgaaagaaggcatcgctgattcg
atggacaccgtggatttggcgatggcaggcgggctgggattcaccagcgatgcaaactgg
tccgaatttttcgccgaactcggcaccgaccaaatcgacagcgccatcagccgatggcaa
gccgagttcaaatccatgcgaaaccaagtggcgtaa

DBGET integrated database retrieval system