Stieleria magnilauensis: TBK1r_55760 Help Entry TBK1r_55760       CDS       T10880                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism smae  Stieleria magnilauensis Pathway smae00998   Biosynthesis of various antibiotics smae01100   Metabolic pathways smae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TBK1r_55760 (acpP_2)    00074 Mycolic acid biosynthesis     TBK1r_55760 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TBK1r_55760 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDV86557 UniProt:  A0ABX5XX21 LinkDB All DBs Position 7464973..7465233 Genome browser AA seq 86 aa AA seqDB search MTPAEIRDEILDILEDISPDEDLDDLKDEVAFREQLELDSMDFLDIVMELRKRHRVQIPE EEYGELASMASTVAYLEPKMRDIVKT NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacgcctgctgaaatccgcgacgaaatcctggacattctcgaagacatttcgccggac gaagacctggacgatttgaaggacgaggttgcgttccgggagcagttggagctcgatagc atggactttttggacatcgtgatggagttgcgaaagcggcaccgtgtccagattcccgag gaggagtacggggagcttgccagtatggcgtccacggtggcgtatcttgaaccgaagatg cgtgacatcgtcaaaacctga

DBGET integrated database retrieval system