Stieleria magnilauensis: TBK1r_57940
Help
Entry
TBK1r_57940 CDS
T10880
Name
(GenBank) ATPase family associated with various cellular activities (AAA)
KO
K03924
MoxR-like ATPase [EC:3.6.3.-]
Organism
smae Stieleria magnilauensis
Brite
KEGG Orthology (KO) [BR:
smae00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99980 Enzymes with EC numbers
TBK1r_57940
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AAA_3
AAA_lid_2
AAA_5
AAA
bpMoxR
Sigma54_activat
RuvB_N
nSTAND3
MCM
AAA_2
Motif
Other DBs
NCBI-ProteinID:
QDV86774
UniProt:
A0ABX5XXM4
LinkDB
All DBs
Position
7782057..7783121
Genome browser
AA seq
354 aa
AA seq
DB search
MFTHGNESRQSETDAESSDAPIADQREPCDSPSAAGRHHTDPDVARGLLGKIETVRTQLQ
SVIRGKADVIDSVLTCILAEGSVLVEDVPGVGKTTLAKSIAALIDLDFQRIQCTPDLLPS
DILGSAIFQPASGEFHFRRGPIFCNLLIADEINRASPRTQSALLEAMAESQVTIDSTQYR
LEKPFIVIATQNPVGFEGTYPLPESQLDRFLFRLSMDYPDQESEIDLLLDQASHDPSSEL
TPVMHRDDLATLQRFVREVTVDRKVVRYLVALVNATRQDTRLRVGCSPRGSKMLLRAAQA
RAVLDQRDYVLPDDIQEVAVAVLAHRVSMRSVSTSWNDAASVIDELMRQTEVVV
NT seq
1065 nt
NT seq
+upstream
nt +downstream
nt
atgttcacccacggaaacgaatcgcgacaatcagaaaccgatgcggagtcgtctgatgcc
ccgattgccgaccagcgggaaccgtgtgattccccctcggccgccggccggcatcacacc
gatcccgacgtcgctcgggggctgttgggaaaaatcgagacggtccggacgcaattgcaa
agcgtgatccgcggcaaagcggacgtcatcgattcggtgttgacctgtatcctggccgaa
gggtcggtgctggtcgaggatgttcccggtgtcggcaaaaccacgctggccaagtccatc
gcggcgctgatcgacttggatttccagcgaatccaatgcacgcccgacctgctgccatcg
gatatcttgggcagcgccattttccagcccgccagcggcgagtttcactttcgtcgcggc
ccgattttttgcaacctgttgatcgccgacgaaatcaaccgcgcctcgccgcgaacccag
agcgccctgttggaggcgatggcagagtcccaggtcacgattgattcgacgcagtaccgg
ttggagaaaccgtttatcgtcatcgcgactcaaaacccggtcggattcgaagggacctat
cccctgccggaatcgcagctggatcgattcttgttccgattgtcgatggattacccggat
caagaaagcgaaattgatttgttgctcgaccaagcatcgcatgacccttcgagcgagctg
acgccggtgatgcatcgtgacgacctggcgacgctgcagcgttttgttcgcgaagtcacg
gtggatcgaaaggtggtccgctatctggtggcgctggtcaatgcgacccgccaagacacg
cggttgcgagtcggttgcagtcctcgcggatcgaagatgttgctgcgtgcggcgcaggct
cgggcggtgctggaccaacgcgattacgtgttgcccgacgacattcaagaagtcgccgtc
gccgtgctcgcccaccgagtttcgatgcgctcggtgtccacgtcatggaatgatgcggcg
tctgtgatcgacgagctgatgcggcagacggaggtggtggtgtga
DBGET
integrated database retrieval system