Serratia sp. FGI94: D781_1195 Help Entry D781_1195         CDS       T02433                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism smaf  Serratia sp. FGI94 Pathway smaf00190   Oxidative phosphorylation smaf01100   Metabolic pathways smaf02020   Two-component system Module smaf_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:smaf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     D781_1195  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     D781_1195 Enzymes [BR:smaf01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      D781_1195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AGB81514 UniProt:  L0MC60 LinkDB All DBs Position 1256470..1256583 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEQSEKTKAQQNGE NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattctcggcacgcttcttgcctgcgcttttggcatcattacg gcgctggcgcttgagcagagcgaaaaaacgaaagcgcagcaaaacggtgaataa

DBGET integrated database retrieval system