Serratia sp. FGI94: D781_2340 Help Entry D781_2340         CDS       T02433                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smaf  Serratia sp. FGI94 Pathway smaf01100   Metabolic pathways smaf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smaf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D781_2340    00074 Mycolic acid biosynthesis     D781_2340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D781_2340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGB82607 UniProt:  L0MH33 LinkDB All DBs Position complement(2479286..2479522) Genome browser AA seq 78 aa AA seqDB search METIEQRVLGALARLQGINKSNMSIDADFFFDLEMDSLDRVEALTLLEQEFARVIPLADA AKFNRVRDVVDYLTPPRA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaaccatagagcaacgggtgctcggcgcgctggccagactgcaggggatcaacaaa tccaatatgtcgattgacgcggatttctttttcgatctggaaatggactcgctggatcgg gtggaggcgctgacgctgctggagcaggagttcgcgcgggtcattccgctggcggatgcc gccaaattcaaccgggtgcgcgacgtggtcgattacctgacgccgccgcgcgcctga

DBGET integrated database retrieval system