Sphingopyxis macrogoltabida EY-1: AN936_19590 Help Entry AN936_19590       CDS       T04104                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism smag  Sphingopyxis macrogoltabida EY-1 Pathway smag02020   Two-component system smag02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:smag00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AN936_19590  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     AN936_19590  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:smag02035]     AN936_19590 Bacterial motility proteins [BR:smag02035]  Flagellar system   Flagellar assembly proteins    Others     AN936_19590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ALH82481 UniProt:  A0A0N9VDN9 LinkDB All DBs Position 4177573..4177875 Genome browser AA seq 100 aa AA seqDB search MSGDSKIGVQAVGGLVRTGATRRIASESAAATRPPVRVAAQDALPVARLITMAGELAAQG PSVDVSRVAALRTAIAGGSYTPDAAATAKAMLAFQKGSGA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtgacagcaagatcggggtgcaagccgtcggcggccttgtccgcaccggcgcc acgcgcaggatcgcaagcgaaagcgctgcggcgacacggccgccggtccgcgtggcggcg caggacgccctgcccgttgcccggctgatcacgatggccggcgaactcgccgcacaggga ccgtcggtcgacgtgtcgcgcgtcgcggcgctgcgcaccgccatcgccggcggcagctat acccccgatgcggccgccaccgccaaggcgatgctggcgttccagaaaggcagcggcgcc tga

DBGET integrated database retrieval system