Shewanella maritima: EXU30_12810 Help Entry EXU30_12810       CDS       T06365                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism smai  Shewanella maritima Brite KEGG Orthology (KO) [BR:smai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smai03036]     EXU30_12810 (zapB) Chromosome and associated proteins [BR:smai03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     EXU30_12810 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA CENP-Q FPP Nuf2_DHR10-like Muted DUF948 ADIP Rootletin Prosystemin Laminin_II Tlp U1snRNP70_N XRCC4_CC NPV_P10 DivIC KIP1 Prominin Motif Other DBs NCBI-ProteinID:  QBF84900 UniProt:  A0A411PMX5 LinkDB All DBs Position complement(2973397..2973597) Genome browser AA seq 66 aa AA seqDB search MSLELLSQLESKIQATLESVELLKMELEEEKQKNEQLTAKNEQLQQDLNSWNDKVNGLVG LLNSET NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagccttgaactattgtcccaactggaaagcaagatccaagcaacacttgaaagtgta gagctactaaaaatggagctcgaagaagagaaacaaaagaacgaacagcttactgctaaa aatgagcagcttcagcaagatctaaactcatggaatgacaaggtgaacggccttgttgga ttgctaaatagcgaaacctaa

DBGET integrated database retrieval system