KEGG   Streptomyces malaysiensis: SMALA_0743
Entry
SMALA_0743        CDS       T05189                                 
Name
(GenBank) cytochrome P450 hydroxylase in cyclooctatin biosynthesis
  KO
K22997  cyclooctat-9-en-7-ol 5-monooxygenase [EC:1.14.99.61]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00997  Biosynthesis of various other secondary metabolites
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
Module
smal_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various other secondary metabolites
    SMALA_0743
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.61  cyclooctat-9-en-7-ol 5-monooxygenase
     SMALA_0743
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ATL80978
UniProt: A0A291SJF6
LinkDB
Position
1075099..1076460
AA seq 453 aa
MTPAKSSAQPERSWTTGTAPGSVPLLGHTLALWRHPLQFLASLPAHGDLVEVRLGPSRAY
LVCHPELVRHVLLNPRTFDKGGVFDKARQLLGNSLSVSRGEEHRSQRRMIQPAFHTPKIS
AYTAAVADDTRAAIGSWEPGRTLDISDTMHALLMRVAARTLFSTGIDEATIDEARHCLRT
VSDGIYKRTMAPLGIMEKLPTPGNRRYDRANARLRQIVDEMIRDRRRSGTDHGDLLSTLL
RAEHPETGKGLDDGEVLDQVVTFLVAGSETTASTLAFVFHLLGAHPEVEKRVHAEIDEVL
EGRVATFEDLPSLEYTRGVITESLRLYPPSWMAMRVTAAETELGGRTIPAGTMILYSAQA
LHHNPELFPDPERFDPERWLPGRAEEVPRGALLPFGAGSHKCIGDVLALTETALIVATIA
SRWRLRPVPGTTLRPEPKATLEPGPLPMVCEPR
NT seq 1362 nt   +upstreamnt  +downstreamnt
gtgactcccgcgaagagctccgcacagccggagcgctcctggaccaccggcacggcgccc
ggctcggtgccgctgctggggcacaccctggcgctctggcgccatccgctccagttcctg
gcctccctgcccgcccacggcgatctggtggaggtcaggctggggcccagccgcgcctat
ctggtctgccatccggagctggtgcgccatgtgctgctcaacccccgtacgttcgacaag
ggcggggtcttcgacaaggcgcggcagttgctcgggaacagcctctcggtctcccggggc
gaggaacaccgctcccagcggcggatgatccagcccgcgttccacaccccgaagatctcc
gcctacaccgccgcggtcgccgatgacacccgcgccgcgatcggctcctgggagccgggg
cggaccctggacatcagcgacaccatgcacgccctgctgatgcgggtcgccgcgcggacc
ctgttctccaccgggatcgacgaggcgacgatcgacgaggcgcgccactgtctgcgcacc
gtctcggacggcatctacaagcgcaccatggcgcccttggggatcatggagaagctcccg
acgccgggcaaccggcgctacgaccgggccaacgcccggctgcggcagatcgtggacgag
atgatccgcgaccggcggcgctccggcaccgaccacggcgatctgctctccacgctgctg
cgcgccgaacaccccgagaccgggaagggattggacgacggcgaggtcctggaccaggtg
gtcaccttcctggtcgccgggagcgagaccaccgcctccaccctcgccttcgtcttccat
ctcctgggcgcccacccggaggtggagaagcgggtgcacgccgagatcgacgaggtcctc
gagggtcgcgtcgccaccttcgaggatctgccgtccctggagtacacccgcggggtcatc
accgagtcgctgcggctgtacccgccgtcctggatggccatgcgggtcacggcggccgag
accgaactcggcggccgcaccatcccggcgggcacgatgatcctctacagcgcccaggcg
ctgcaccacaaccccgaactgttccccgaccccgagcggttcgaccccgagcgctggctc
cccggccgcgccgaggaggtgccgcgcggagcgctgctcccgttcggcgcgggcagccac
aagtgcatcggggacgtcctggcgctgaccgagaccgccctcatcgtggcgacgatcgcg
agccggtggcgtcttcgcccggtgcccgggaccaccttgcgccccgagccgaaggcgacc
ctcgaacccggcccgctgcccatggtgtgcgagccgcgctga

DBGET integrated database retrieval system