Streptomyces marincola: CAG99_06020 Help Entry CAG99_06020       CDS       T08123                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smao  Streptomyces marincola Pathway smao00998   Biosynthesis of various antibiotics smao01100   Metabolic pathways smao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CAG99_06020    00074 Mycolic acid biosynthesis     CAG99_06020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CAG99_06020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARQ68469 UniProt:  A0A1W7CUV3 LinkDB All DBs Position complement(1422070..1422330) Genome browser AA seq 86 aa AA seqDB search MSEQSVVPAIEAALSEVLEREVTGLTPDVRLFEDLHLDSTSVLELLMALEDAVGISVDPE NLDMDDFTSVGTLTAYVVAQQATSGV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtccgagcagagcgtggtgccggccatcgaagccgcactgagcgaggtactggaacgc gaggtcaccggactgaccccggacgtgcggctgttcgaggacctgcacctcgattccacc tccgtcctcgaacttctgatggcccttgaggatgcggtcggcatctcggtcgacccggag aacctcgacatggacgacttcacgtccgtgggcacgctgaccgcgtacgtggtggcccag caggccaccagcggcgtctga

DBGET integrated database retrieval system