Streptomyces marincola: CAG99_07515 Help Entry CAG99_07515       CDS       T08123                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism smao  Streptomyces marincola Brite KEGG Orthology (KO) [BR:smao00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CAG99_07515 Enzymes [BR:smao01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CAG99_07515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like Thioredoxin GST_N_3 GST_N_2 Motif Other DBs NCBI-ProteinID:  ARQ68721 UniProt:  A0A1W7CV92 LinkDB All DBs Position 1774744..1775001 Genome browser AA seq 85 aa AA seqDB search MSGTVTMYSTSWCGYCRRLKSQLDREGISFTEINIEEDTSAVAIVEKANNGNRTVPTVVV APESGGDEVTMTNPSLADVKRALAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcgggcaccgtgacgatgtacagcacctcctggtgcggctactgccgccggctcaag agccagctggaccgggagggcatctccttcaccgagatcaacatcgaggaggacacctcc gcggtcgccatcgtggagaaggccaacaacggcaaccgcaccgtgccgaccgtcgtggtc gccccggagagcggcggcgacgaggtcaccatgaccaacccctcgctcgccgacgtcaag cgggccctggccgcctga

DBGET integrated database retrieval system