Serratia marcescens SM39: SM39_2405 Help Entry SM39_2405         CDS       T03592                                  Symbol fliE Name (GenBank) flagellar basal-body component   KO K02408   flagellar hook-basal body complex protein FliE Organism smar  Serratia marcescens SM39 Pathway smar02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:smar00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     SM39_2405 (fliE)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:smar02035]     SM39_2405 (fliE) Bacterial motility proteins [BR:smar02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     SM39_2405 (fliE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FliE Motif Other DBs NCBI-ProteinID:  BAO34411 UniProt:  A0AAT9F2R3 LinkDB All DBs Position complement(2467245..2467559) Genome browser AA seq 104 aa AA seqDB search MAIQGIEGVLQQMQTMAVQAGKMGQNTAPQGVSFASELTAALGKISETQQTARKQAQDFE LGVPGISLNDVMVDLQKSSVSLQMGVQVRNKLVAAYQDIMNMPV NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcgattcagggcattgaaggggtgctgcagcagatgcagaccatggcggttcaggcc ggcaagatggggcagaatacggcgccgcagggcgtcagcttcgccagcgaactgactgcg gcgctcggcaagatcagcgagacccagcaaacggcgcgcaagcaggcgcaggatttcgaa ctgggcgtgccgggcatcagcctgaacgatgtgatggtcgatctgcagaaatcatcggtc tcgctgcagatgggcgtgcaggtgcgcaacaagctggtcgcggcctaccaggacatcatg aatatgccggtgtga

DBGET integrated database retrieval system