KEGG   Serratia marcescens SM39: SM39_2891
Entry
SM39_2891         CDS       T03592                                 
Symbol
nuoM
Name
(GenBank) NADH:ubiquinone oxidoreductase, membrane subunit M
  KO
K00342  NADH-quinone oxidoreductase subunit M [EC:7.1.1.2]
Organism
smar  Serratia marcescens SM39
Pathway
smar00190  Oxidative phosphorylation
smar01100  Metabolic pathways
Module
smar_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SM39_2891 (nuoM)
Enzymes [BR:smar01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     SM39_2891 (nuoM)
SSDB
Motif
Pfam: Proton_antipo_M Proton_antipo_N
Other DBs
NCBI-ProteinID: BAO34871
UniProt: A0AAT9DZM8
LinkDB
Position
complement(2967022..2968551)
AA seq 509 aa
MLLPWLILIPFIGGLLCWQLERFGTKVPRWIALIAMGLTLALSLQLWLQGGYTLTTPKGI
PQWQSEFLLPWIPRFGISIHLALDGLSLLMVVLTGLLGVLAILCSWREIQKYQGFFHLNL
LWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQA
SGLVMLIAILGLVFVHYNATGVWTFDYEDLLQTPMSHNVQYLLMLGFFIAFAVKMPVVPL
HGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPEASHEFAPIAMWLGVIGIFY
GAWMAFAQTDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAAGMFIICG
QLYERLHTRDMRQMGGLWGRIKFIPALSLFFAVATLGMPGTGNFVGEFMILFGSYQVVPV
ITVISTFGLVFASVYSLIMMQRAYYGAPKSDQPLQGMTARELFIILLLVVLLVLLGVYPQ
PILDTSNAAMSNVQHWFGSSVSAISTTRP
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgctattaccttggctaattcttatcccctttatcggcggtctgctgtgctggcagctt
gagcgcttcggtactaaggtgccgcgctggatagcgctgatcgcaatggggctgacgttg
gcgctctctctgcagctgtggctgcagggcggctataccttgaccacgccgaaaggcatt
ccgcagtggcagagcgaattcctgctgccgtggatcccgcgcttcggcatctccatccac
ctggcgctggacggcctgtcgctgctgatggtggtgttgaccggtctgctgggcgtgctg
gcgatcctctgttcctggcgtgaaatccagaagtatcagggcttcttccacctcaacctg
ctgtggatcctgggcggcgttatcggcgtgttcctcgccatcgacatgttcctgttcttc
ttcttctgggaaatgatgttggtgccgatgtacttcctgatcgcgttgtggggccacaag
gcgtcggacggtaaaacccgcatcaccgcggcgaccaagttcttcatctacacccaggcc
agcggtctggtgatgctgattgcgatcctgggcctggtgttcgtgcactacaacgccacc
ggcgtgtggaccttcgattacgaagacctgctgcaaacgccgatgtcccacaacgtgcaa
tatctgttgatgctgggcttcttcatcgccttcgcggtgaaaatgccggtggtgccgctg
cacggctggttgccggacgcgcacagccaggcgccgaccgcaggttccgtcgacctggcg
ggcatcttgctgaaaaccgctgcctacggcctgctgcgtttcagcctgccgctgttccct
gaggcttcgcacgagtttgcgccaatcgccatgtggctgggcgtgatcggcatcttctac
ggcgcctggatggcgttcgcgcagaccgacatcaagcgtcttatcgcctacacctcggtc
tcgcacatgggcttcgtgctgatcgccatctacaccggcagccagttggcttatcagggc
gcggtgatccagatgatcgcgcacggcctgtccgccgccggtatgtttatcatctgcggc
cagctgtatgagcgcctgcatacccgcgacatgcgtcagatgggcggcctgtgggggcgt
atcaagttcatccctgcgctgtcgctgttcttcgccgtggctacgctggggatgccgggt
accggtaacttcgtcggcgaattcatgattctgttcggcagctaccaggtggtgccggtg
atcaccgtgatttctaccttcggtctggtgttcgcttcggtttactcgctgatcatgatg
cagcgcgcttactacggtgcgcctaaatccgaccagccgctgcagggcatgaccgcgcgc
gaactgttcatcattctgctgctggtggtgttgctggttctgctgggggtttacccgcag
ccgattctggatacttccaacgcggcgatgagcaacgtgcaacactggtttggttcgtca
gtttcagcaatttcaacaacaaggccgtaa

DBGET integrated database retrieval system