Candidatus Sulfurimonas marisnigri: HUE87_11690 Help Entry HUE87_11690       CDS       T07564                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smas  Candidatus Sulfurimonas marisnigri Pathway smas01100   Metabolic pathways smas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HUE87_11690    00074 Mycolic acid biosynthesis     HUE87_11690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HUE87_11690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GIP1_N Motif Other DBs NCBI-ProteinID:  QOY54514 UniProt:  A0A7S7M1H0 LinkDB All DBs Position 2315486..2315728 Genome browser AA seq 80 aa AA seqDB search MTKEELKRAIIEQILEIAPDVDESEIDPDANIQRSLEIDSFDFLKILTSLNEKVGIEVPE ADYAKVDTVKHMAEYFSKHL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagaggaactaaaacgggcaataattgagcaaattttggaaattgcccccgat gtagatgagagtgagatagatccagatgcgaatattcagcgctctttagagatagactcg tttgattttttaaaaattcttacatccttgaatgaaaaagttggtattgaagttcctgag gccgattatgccaaggttgatactgtcaagcatatggctgagtacttctcaaaacatttg taa

DBGET integrated database retrieval system