Scophthalmus maximus (turbot): 118285451 Help Entry 118285451         CDS       T09850                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism smau  Scophthalmus maximus (turbot) Pathway smau04060   Cytokine-cytokine receptor interaction smau04218   Cellular senescence smau04620   Toll-like receptor signaling pathway smau04621   NOD-like receptor signaling pathway smau04622   RIG-I-like receptor signaling pathway smau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118285451 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     118285451 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118285451 (cxcl19)    04621 NOD-like receptor signaling pathway     118285451 (cxcl19)    04622 RIG-I-like receptor signaling pathway     118285451 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118285451 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:smau04052]     118285451 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:smau00536]     118285451 (cxcl19) Cytokines and neuropeptides [BR:smau04052]  Cytokines   Chemokines    118285451 (cxcl19) Glycosaminoglycan binding proteins [BR:smau00536]  Heparan sulfate / Heparin   Chemokines    118285451 (cxcl19) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118285451 NCBI-ProteinID:  XP_035465019 LinkDB All DBs Position 12:6583257..6585730 Genome browser AA seq 105 aa AA seqDB search MKLCIPFVFLSVFVLVHGMPPISRDYNKHCRCLQVESRIIPPDNLRSIKLVPEGPHCPDI EVIAGLASGEKVCLNPRSSWVKKLVHFVLEKQLHQQGGALAKNEA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatcccgttcgtgttcctgtccgtctttgtcctcgtccacgggatgccg ccgatcagcagggactacaacaagcactgccgctgcctgcaggtggagtcgaggatcatc ccgcccgacaacctgaggagcatcaagctggtccctgagggcccccactgcccagacata gaagtcatagctggactggcgagcggggagaaggtctgcctgaaccctcggtcgtcgtgg gtgaagaagctggtccactttgttctggagaagcagctccatcagcagggcggcgcgctc gccaagaatgaagcctga

DBGET integrated database retrieval system