Scophthalmus maximus (turbot): 118287676 Help Entry 118287676         CDS       T09850                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism smau  Scophthalmus maximus (turbot) Pathway smau04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:smau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118287676  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:smau04121]     118287676    03400 DNA repair and recombination proteins [BR:smau03400]     118287676 Ubiquitin system [BR:smau04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      118287676    Cul5 complex      118287676 DNA repair and recombination proteins [BR:smau03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118287676 BRITE hierarchy Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  118287676 NCBI-ProteinID:  XP_035468991 EnsemblRapid:  ENSSMAG00025017315 LinkDB All DBs Position 16:complement(12117490..12121671) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLAFRVNDEMFEQLHVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttgatgatccggcgtcacaagactacaatcttcacagatgccaaggag tccaccactgtctatgagctgaagcgtatcgtagaaggaattctgaaaagaccacctgaa gaccagcggctctacaaagatgaccagttgctagaggacagcaaaacgctgggagactgt ggattcaccaatcagactgccagacctcaagccccagccacggttggtctggccttccgt gttaatgatgagatgttcgagcagctgcacgtcgaggccttctccagtcccccggaactc cccgatgtgatgaagcctcaggactctggtagcactgccaatgaacaggcggtgcagtga

DBGET integrated database retrieval system