Scophthalmus maximus (turbot): 118288595 Help Entry 118288595         CDS       T09850                                  Symbol zgc:55558 Name (RefSeq) GTPase KRas   KO K07827   GTPase KRas Organism smau  Scophthalmus maximus (turbot) Pathway smau04010   MAPK signaling pathway smau04012   ErbB signaling pathway smau04068   FoxO signaling pathway smau04137   Mitophagy - animal smau04140   Autophagy - animal smau04150   mTOR signaling pathway smau04210   Apoptosis smau04218   Cellular senescence smau04370   VEGF signaling pathway smau04371   Apelin signaling pathway smau04519   Cadherin signaling smau04540   Gap junction smau04625   C-type lectin receptor signaling pathway smau04810   Regulation of actin cytoskeleton smau04910   Insulin signaling pathway smau04912   GnRH signaling pathway smau04914   Progesterone-mediated oocyte maturation smau04916   Melanogenesis Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118288595 (zgc:55558)    04012 ErbB signaling pathway     118288595 (zgc:55558)    04370 VEGF signaling pathway     118288595 (zgc:55558)    04371 Apelin signaling pathway     118288595 (zgc:55558)    04068 FoxO signaling pathway     118288595 (zgc:55558)    04150 mTOR signaling pathway     118288595 (zgc:55558)   09133 Signaling molecules and interaction    04519 Cadherin signaling     118288595 (zgc:55558)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118288595 (zgc:55558)    04137 Mitophagy - animal     118288595 (zgc:55558)   09143 Cell growth and death    04210 Apoptosis     118288595 (zgc:55558)    04218 Cellular senescence     118288595 (zgc:55558)   09144 Cellular community - eukaryotes    04540 Gap junction     118288595 (zgc:55558)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118288595 (zgc:55558)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118288595 (zgc:55558)   09152 Endocrine system    04910 Insulin signaling pathway     118288595 (zgc:55558)    04912 GnRH signaling pathway     118288595 (zgc:55558)    04914 Progesterone-mediated oocyte maturation     118288595 (zgc:55558)    04916 Melanogenesis     118288595 (zgc:55558)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smau04131]     118288595 (zgc:55558)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:smau04031]     118288595 (zgc:55558) Membrane trafficking [BR:smau04131]  Endocytosis   Macropinocytosis    Ras GTPases     118288595 (zgc:55558) GTP-binding proteins [BR:smau04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118288595 (zgc:55558) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N POC3_POC4 SatRNA_48 ATP_bind_1 MeaB Septin TP0183_N Ldh_1_N Motif Other DBs NCBI-GeneID:  118288595 NCBI-ProteinID:  XP_035470754 UniProt:  A0A2U9CSE3 LinkDB All DBs Position 17:complement(9015369..9019852) Genome browser AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL STRTVATQQAQELARSYSVPFVETSAKTRQGVEEAFYSLVREIRKYKETNRSNKKSKKNN QRRCLIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactggtggtggtgggggccgggggcgtggggaagagcgcgctcacc atccagctcatccagaaccacttcgtcgacgaatatgatccaaccatcgaggactcgtac aggaagcaggtggtgattgacggggagacgtgtctgttggacatcctggacactgcgggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtgtttgccatcaacaactccaagtcctttgaggacgttcacctctacagagagcagatc aacagggtgaaggacagcgacagcgttcccatggtgctggtggggaacaagagcgacctg agtacccgcactgtggcgacgcaacaggcacaggagctggcgcggagctacagtgtgccg tttgttgagacgtcagccaaaaccagacagggtgtggaggaagctttctattcgctggta cgggagattcgaaaatataaggagaccaaccgcagcaacaagaagagcaagaagaacaat cagagacgttgcttaatactatag

DBGET integrated database retrieval system