Scophthalmus maximus (turbot): 118288685 Help Entry 118288685         CDS       T09850                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism smau  Scophthalmus maximus (turbot) Pathway smau04010   MAPK signaling pathway smau04137   Mitophagy - animal smau04140   Autophagy - animal smau04218   Cellular senescence smau04371   Apelin signaling pathway smau04625   C-type lectin receptor signaling pathway smau04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118288685 (rras)    04371 Apelin signaling pathway     118288685 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118288685 (rras)    04137 Mitophagy - animal     118288685 (rras)   09143 Cell growth and death    04218 Cellular senescence     118288685 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118288685 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118288685 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smau04147]     118288685 (rras)    04031 GTP-binding proteins [BR:smau04031]     118288685 (rras) Exosome [BR:smau04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118288685 (rras)   Exosomal proteins of bladder cancer cells    118288685 (rras) GTP-binding proteins [BR:smau04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118288685 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  118288685 NCBI-ProteinID:  XP_035470937 LinkDB All DBs Position 17:1348431..1355304 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQVLRVKDRDDFPIVLVGN KADLEQQRVISREDAQAFASDNGIHYMESSAKNRYNVDESFLELVKIIRRFQEMESTPPA AHHTGKQKSGGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcagaagaggagaggttcaaactggtggtggtgggaggaggaggggtgggcaag agcgccctgaccatccagttcatccagtcctactttgtgtccgattacgatcccaccatc gaagactcctacaccaagatctgcaccgtggatggaaaagagacccggctggacatcttg gatacagcaggtcaggaggagtttggggcaatgagggagcagtacatgcgctcaggagaa ggcttcttactggtgtttgcactcaacgacaggggcagctaccatgaggtccagaaattc cacactcaggtcctgagagtgaaggaccgagacgacttccccattgtgctggttggaaac aaggccgacctggaacagcagagagtgatctccagggaggacgctcaggcttttgccagc gacaacggcatccactatatggagtcttccgccaagaatcgctacaacgtggatgagtcc tttttggaattggttaaaatcatcaggaggttccaggagatggagagtactcctcctgca gcgcaccacacgggaaaacagaagagtgggggctgtccctgtgtcctcctctaa

DBGET integrated database retrieval system