Scophthalmus maximus (turbot): 118292475 Help Entry 118292475         CDS       T09850                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism smau  Scophthalmus maximus (turbot) Pathway smau04382   Cornified envelope formation smau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smau00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     118292475 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118292475 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smau04147]     118292475 (s100a10a) Exosome [BR:smau04147]  Exosomal proteins   Exosomal proteins of microglial cells    118292475 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH NNH2 DUF7078 EF-hand_11 Motif Other DBs NCBI-GeneID:  118292475 NCBI-ProteinID:  XP_035477357 UniProt:  A0A2U9D3M8 LinkDB All DBs Position 22:9334291..9335845 Genome browser AA seq 100 aa AA seqDB search MPSELENAMESLIKVFHRYASDDGKSTTLNRRELRSLMENELSNFLQSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYKMHIRKSVKH NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaaaacgccatggagtcactcatcaaggtgttccaccgttacgcc tccgacgacggcaagagcaccacgctcaaccggcgagagctcagaagcctgatggagaac gagctgtccaacttccttcagtcccagaaggaccccgctgccgtggacaagatcatgaag gacctggacaccaacggggacggccaggtggactttgaggagtttgtttctctggtagtt ggactttccattgcctgtgagcagtgctacaagatgcacataaggaagtcagtaaagcat taa

DBGET integrated database retrieval system