Scophthalmus maximus (turbot): 118301540 Help Entry 118301540         CDS       T09850                                  Name (RefSeq) insulin   KO K04526   insulin Organism smau  Scophthalmus maximus (turbot) Pathway smau04010   MAPK signaling pathway smau04068   FoxO signaling pathway smau04081   Hormone signaling smau04114   Oocyte meiosis smau04140   Autophagy - animal smau04150   mTOR signaling pathway smau04810   Regulation of actin cytoskeleton smau04910   Insulin signaling pathway smau04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118301540    04068 FoxO signaling pathway     118301540    04150 mTOR signaling pathway     118301540   09133 Signaling molecules and interaction    04081 Hormone signaling     118301540  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118301540   09143 Cell growth and death    04114 Oocyte meiosis     118301540   09142 Cell motility    04810 Regulation of actin cytoskeleton     118301540  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     118301540    04914 Progesterone-mediated oocyte maturation     118301540  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:smau04052]     118301540 Cytokines and neuropeptides [BR:smau04052]  Neuropeptides   Unclassified    118301540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  118301540 NCBI-ProteinID:  XP_035483039 UniProt:  A0A2U9B879 LinkDB All DBs Position 2:complement(19411543..19412820) Genome browser AA seq 123 aa AA seqDB search MAALWLYNVSLLVLLVTSFPGSQAIAAQHLCGAHLVEALYLVCGERGFIYQPRSDNSALR LLPPMAGRAVSVGGEKKLSEFAFQDQMEMMAKRTILDRCCHRPCNLFELEEFCHPPASSD TSA NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggcagcactgtggctctataatgtttctctgctggtcttactggtcacgtcgttcccg ggttcccaagccattgccgcgcagcacctctgtggcgctcacctggttgaggccctttac ctggtctgtggagagagaggttttatctaccaacccaggagcgacaactctgcactgcgt ctcttgcctccaatggccggcagagcagtgtcagtgggcggcgagaaaaagctctcggag ttcgccttccaggaccagatggagatgatggcgaagcgaacgattttggaccgatgctgt cacaggccctgcaacctcttcgaactggaggaattctgccacccaccagccagctcggac accagcgcttaa

DBGET integrated database retrieval system