Scophthalmus maximus (turbot): 118302091 Help Entry 118302091         CDS       T09850                                  Symbol calml4a Name (RefSeq) calmodulin-like protein 4a   KO K02183   calmodulin Organism smau  Scophthalmus maximus (turbot) Pathway smau04020   Calcium signaling pathway smau04070   Phosphatidylinositol signaling system smau04114   Oocyte meiosis smau04218   Cellular senescence smau04261   Adrenergic signaling in cardiomyocytes smau04270   Vascular smooth muscle contraction smau04371   Apelin signaling pathway smau04625   C-type lectin receptor signaling pathway smau04744   Phototransduction smau04910   Insulin signaling pathway smau04912   GnRH signaling pathway smau04916   Melanogenesis Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     118302091 (calml4a)    04020 Calcium signaling pathway     118302091 (calml4a)    04070 Phosphatidylinositol signaling system     118302091 (calml4a)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     118302091 (calml4a)    04218 Cellular senescence     118302091 (calml4a)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118302091 (calml4a)   09152 Endocrine system    04910 Insulin signaling pathway     118302091 (calml4a)    04912 GnRH signaling pathway     118302091 (calml4a)    04916 Melanogenesis     118302091 (calml4a)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     118302091 (calml4a)    04270 Vascular smooth muscle contraction     118302091 (calml4a)   09157 Sensory system    04744 Phototransduction     118302091 (calml4a)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:smau01009]     118302091 (calml4a)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smau04131]     118302091 (calml4a)    03036 Chromosome and associated proteins [BR:smau03036]     118302091 (calml4a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smau04147]     118302091 (calml4a) Protein phosphatases and associated proteins [BR:smau01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118302091 (calml4a) Membrane trafficking [BR:smau04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     118302091 (calml4a) Chromosome and associated proteins [BR:smau03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      118302091 (calml4a) Exosome [BR:smau04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118302091 (calml4a) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 CFAP251_C EF-hand_9 EF-hand_5 EH Flagellar_rod GPHH EF-hand_EFHB_C WHD_DnaB FlgD EF-hand_11 Motif Other DBs NCBI-GeneID:  118302091 NCBI-ProteinID:  XP_035483842 LinkDB All DBs Position 4:5411364..5416293 Genome browser AA seq 153 aa AA seqDB search MAKFFTPVQINEFKECFSLYDKKQKGKIDAKDLVTVMRCLGTSPTFGEIERHLQVHKIEK TGELDFSSFLTMMHRQMQQEDPKTEILEALRMTDKQKRGYIQASELRAKLTKLGEKLTDK EVDDLFKEANVESNGTVNHEEFTKMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctaagttcttcactccagttcaaatcaacgaattcaaggaatgcttctccttgtac gacaagaagcaaaagggcaagatcgacgccaaggacctcgtcacagttatgcgctgcctg ggtacaagtcccacgttcggggaaatcgaaaggcatctgcaagttcacaaaattgaaaag accggcgagctggatttctcctccttcctgacgatgatgcaccgacagatgcagcaggag gatcccaagacggaaatcctggaggccctgcggatgacggacaagcagaagcgaggatac atccaggcgtccgagctccgggccaagctcaccaagttgggagagaaactcacggacaaa gaagtggacgatctcttcaaagaggccaacgtcgagtcaaacgggacggtgaatcacgag gagttcaccaagatggtgacgctgccaccagtcgattactga

DBGET integrated database retrieval system