Scophthalmus maximus (turbot): 118302474 Help Entry 118302474         CDS       T09850                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism smau  Scophthalmus maximus (turbot) Pathway smau04010   MAPK signaling pathway smau04137   Mitophagy - animal smau04140   Autophagy - animal smau04218   Cellular senescence smau04371   Apelin signaling pathway smau04519   Cadherin signaling smau04625   C-type lectin receptor signaling pathway smau04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118302474 (rras2)    04371 Apelin signaling pathway     118302474 (rras2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     118302474 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118302474 (rras2)    04137 Mitophagy - animal     118302474 (rras2)   09143 Cell growth and death    04218 Cellular senescence     118302474 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118302474 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118302474 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smau04147]     118302474 (rras2)    04031 GTP-binding proteins [BR:smau04031]     118302474 (rras2) Exosome [BR:smau04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118302474 (rras2)   Exosomal proteins of bladder cancer cells    118302474 (rras2) GTP-binding proteins [BR:smau04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118302474 (rras2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase RHG35-p190PhoGP_pG1 CTD10 Motif Other DBs NCBI-GeneID:  118302474 NCBI-ProteinID:  XP_035484528 UniProt:  A0A8D3BJ31 LinkDB All DBs Position 4:11507464..11533810 Genome browser AA seq 202 aa AA seqDB search MAGWKDASVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLEPQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggccggatggaaggacgcctcggtgcaggagaagtaccggctggtggtggtcggaggc ggcggcgtcgggaagtcagccctgacgatccagttcatccagtcctacttcgtcactgac tatgatcccacgatcgaagactcctacacaaagcagtgtgtgattgacgaaagggcggcc aggcttgacatcctcgacacggccggacaggaagagtttggagccatgagagaacaatac atgaggacaggggagggcttcctgctcgtcttctccgtcactgacaggggaagctttgaa gaaatctacaaattccaaagacaaattctccgagtcaaagaccgagatgagttcccgatg atccttgtaggaaacaaagcagatctggaaccacagagacaagtaacccaggaagagggc cagcagctggccagacagctgaaggtcacatacatggaggcttcagccaaaatccgcatg aacgtagaccaagctttccacgagctggttagggtaatcaggaaattccaagaacaggaa tgtccaccgtcgccagaacccacaaggaaagagaaagacaagagcggctgccactgtgtg atcgtctga

DBGET integrated database retrieval system