Scophthalmus maximus (turbot): 118307725 Help Entry 118307725         CDS       T09850                                  Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism smau  Scophthalmus maximus (turbot) Pathway smau04814   Motor proteins smau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smau00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     118307725  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118307725  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:smau03037]     118307725    04812 Cytoskeleton proteins [BR:smau04812]     118307725 Cilium and associated proteins [BR:smau03037]  Motile cilia and associated proteins   Dynein arm    118307725 Cytoskeleton proteins [BR:smau04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      118307725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  118307725 NCBI-ProteinID:  XP_035485816 LinkDB All DBs Position 1:29203546..29206051 Genome browser AA seq 114 aa AA seqDB search MEEFHNGNEGSFNSEEADNIVKECIEGVVGADDYSQSLVNKWTASIVERCLTQLVKQGKP YKYMVTCAVMQKTGAGLHTANSCYWDTTMDGSCTVRWENRTMYCVVSVFAVAIA NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaggagtttcacaacggcaacgagggatccttcaactctgaggaggctgataacatt gtgaaagagtgcatcgagggcgtggtgggcgctgacgactacagccagagtctggtgaac aagtggacggccagcatcgtggagcgctgcctcacgcagctggtcaaacaggggaaaccg tacaagtacatggtgacgtgtgctgtgatgcagaaaactggggcaggactccacacagcc aactcctgctactgggacacgaccatggacggaagctgcacggtgaggtgggaaaaccgc accatgtactgtgtggtcagtgtgttcgctgtggccatcgcatag

DBGET integrated database retrieval system