Scophthalmus maximus (turbot): 118309280 Help Entry 118309280         CDS       T09850                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism smau  Scophthalmus maximus (turbot) Pathway smau04081   Hormone signaling smau04144   Endocytosis smau04150   mTOR signaling pathway smau04270   Vascular smooth muscle contraction smau04310   Wnt signaling pathway smau04350   TGF-beta signaling pathway smau04510   Focal adhesion smau04520   Adherens junction smau04530   Tight junction smau04621   NOD-like receptor signaling pathway smau04625   C-type lectin receptor signaling pathway smau04810   Regulation of actin cytoskeleton smau05100   Bacterial invasion of epithelial cells smau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118309280    04350 TGF-beta signaling pathway     118309280    04150 mTOR signaling pathway     118309280   09133 Signaling molecules and interaction    04081 Hormone signaling     118309280  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118309280   09144 Cellular community - eukaryotes    04510 Focal adhesion     118309280    04520 Adherens junction     118309280    04530 Tight junction     118309280   09142 Cell motility    04810 Regulation of actin cytoskeleton     118309280  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118309280    04625 C-type lectin receptor signaling pathway     118309280   09153 Circulatory system    04270 Vascular smooth muscle contraction     118309280  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118309280    05100 Bacterial invasion of epithelial cells     118309280  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smau04131]     118309280   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smau04147]     118309280    04031 GTP-binding proteins [BR:smau04031]     118309280 Membrane trafficking [BR:smau04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     118309280 Exosome [BR:smau04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118309280   Exosomal proteins of other body fluids (saliva and urine)    118309280   Exosomal proteins of colorectal cancer cells    118309280   Exosomal proteins of bladder cancer cells    118309280 GTP-binding proteins [BR:smau04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     118309280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  118309280 NCBI-ProteinID:  XP_035487104 LinkDB All DBs Position 6:12986014..12989985 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEDGRDMANRISAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKSSKCVLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatcaggaaaaagctggtcatagtgggagacggagcctgtgggaagacgtgt ctgctcatcgtgttcagcaaggaccagtttccggaggtctacgtgcccacggtcttcgag aactacgtcgccgacatcgaagttgatggcaaacaggtggagttagcgctttgggataca gcaggtcaagaagactatgacagactgcgtccactctcttatccagacaccgatgtcatt ctcatgtgcttctccattgacagtcctgacagtctggagaacatcccggagaagtggacc cccgaggtgaaacacttctgccccaatgttcccattatactggtgggaaataaaaaggac ctgcgtaacgatgagcacacccggagggagctcgccaaaatgaagcaggaacctgtgaaa ccagaggatggacgggacatggccaaccggatcagtgcctttggatacatggagtgttct gcaaaaacaaaggatggtgtgagggaagtgtttgagatggccaccagggctgcactacag gccaggcggggaaagaagagcagtaaatgtgtcctactgtaa

DBGET integrated database retrieval system