Scophthalmus maximus (turbot): 118309385 Help Entry 118309385         CDS       T09850                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism smau  Scophthalmus maximus (turbot) Pathway smau04810   Regulation of actin cytoskeleton smau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smau00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118309385 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118309385 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  118309385 NCBI-ProteinID:  XP_035487335 UniProt:  A0A8D3CWU5 LinkDB All DBs Position 6:complement(11721651..11723024) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggccaggaggatccagtgcagagagagattcaccaagactgggcgaatcgagag tacatcgaggtgatcacgagcagcatcaaaaagatcgccgacttcctgaactcgttcgat atgtcgtgtcgatcccgtctggccactctaaatgagaagctgacagcgttggagaggagg attgaatacattgaggccagagtgacaaaaggcgagaccttgacctag

DBGET integrated database retrieval system