Scophthalmus maximus (turbot): 118309471 Help Entry 118309471         CDS       T09850                                  Symbol myl6 Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism smau  Scophthalmus maximus (turbot) Pathway smau04270   Vascular smooth muscle contraction smau04530   Tight junction smau04814   Motor proteins Brite KEGG Orthology (KO) [BR:smau00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     118309471 (myl6)   09142 Cell motility    04814 Motor proteins     118309471 (myl6)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     118309471 (myl6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:smau04812]     118309471 (myl6)    04147 Exosome [BR:smau04147]     118309471 (myl6) Cytoskeleton proteins [BR:smau04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      118309471 (myl6) Exosome [BR:smau04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118309471 (myl6)   Exosomal proteins of bladder cancer cells    118309471 (myl6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_6 EF-hand_1 EF-hand_7 EF_EFCAB10_C AIF-1 EF-hand_8 Motif Other DBs NCBI-GeneID:  118309471 NCBI-ProteinID:  XP_035487536 UniProt:  A0A8D2ZL90 LinkDB All DBs Position 6:14539215..14542414 Genome browser AA seq 151 aa AA seqDB search MSDFSEDQILEFKEAFLLFDRTGEGKITYSQCGDVMRALGQNPVNAEVLKVLGNPKLEEM NHKMLDFEQFLPMLQAIAKNKDQGSYEDIVEGLRVFDKEGNGTVMGAELRHVLTTLGEKM TEEEVETLLAGHEDANGCINYEELVRMVMSG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctgacttctcagaggaccagatccttgagttcaaggaggccttcctcttgttcgac cggaccggtgaggggaagatcacctacagccagtgtggcgatgtcatgcgggcccttggg cagaaccccgtcaatgctgaggtgctcaaagtcttgggaaaccccaaattagaagagatg aaccacaagatgctggattttgagcagttcctgcccatgcttcaggccattgctaagaac aaagaccagggctcctatgaggacatcgtagagggcctgcgagtctttgacaaggaggga aatggaacagtgatgggagcagagcttcgtcatgtcctcacaacattaggtgaaaaaatg acagaggaggaggtggagactcttttagcaggacatgaagacgccaatggctgtattaac tatgaagaactcgtccggatggtgatgagcggttga

DBGET integrated database retrieval system