Scophthalmus maximus (turbot): 118309758 Help Entry 118309758         CDS       T09850                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism smau  Scophthalmus maximus (turbot) Pathway smau04137   Mitophagy - animal smau04140   Autophagy - animal smau04144   Endocytosis smau04145   Phagosome smau04148   Efferocytosis smau05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smau00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118309758    04145 Phagosome     118309758    04140 Autophagy - animal     118309758    04137 Mitophagy - animal     118309758    04148 Efferocytosis     118309758  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118309758  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smau04131]     118309758   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smau04147]     118309758    04031 GTP-binding proteins [BR:smau04031]     118309758 Membrane trafficking [BR:smau04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     118309758 Exosome [BR:smau04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118309758   Exosomal proteins of other body fluids (saliva and urine)    118309758   Exosomal proteins of colorectal cancer cells    118309758   Exosomal proteins of bladder cancer cells    118309758 GTP-binding proteins [BR:smau04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     118309758 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  118309758 NCBI-ProteinID:  XP_035488129 LinkDB All DBs Position 6:complement(14120227..14132081) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcttgaaagtcatcatcctgggagattctggtgttgga aaaacctccctgatgaaccagtatgtgaacaagaagttcagcaaccagtacaaagcgacg ataggagcggacttcctcacgaaggaagtgatggtggatgaccgactcgttacaatgcag atttgggacaccgctggccaggagaggttccagtccttgggtgttgcgttctaccgtgga gcagactgctgtgtgctggtgtttgatgtgaccgcaccaaacactttcaagacacttgac agctggagggatgagttcctgatccaggccagcccccgagatcctgagaacttccccttt gtggtgctaggcaacaagatcgacttggagaatagacaggtaaccaccaaaagggcccag gcttggtgtcagagtaagaacaacatcccctactttgagaccagtgccaaagaagccatt aacgtagaacaggcattccagactattgcacgtaacgccctcaaacaggagacagaggtg gagttgtataatgaattccctgagcccatcaaactggataggaacgacagagctaaacct tcagcagaaagctgcagttgctga

DBGET integrated database retrieval system