Scophthalmus maximus (turbot): 118310304 Help Entry 118310304         CDS       T09850                                  Symbol ccl25a Name (RefSeq) C-C motif chemokine 25   KO K13072   C-C motif chemokine 25 Organism smau  Scophthalmus maximus (turbot) Pathway smau04060   Cytokine-cytokine receptor interaction smau04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118310304 (ccl25a)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     118310304 (ccl25a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:smau04052]     118310304 (ccl25a) Cytokines and neuropeptides [BR:smau04052]  Cytokines   Chemokines    118310304 (ccl25a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  118310304 NCBI-ProteinID:  XP_035489002 UniProt:  A0A2U9BIN3 LinkDB All DBs Position 5:complement(21997964..22000416) Genome browser AA seq 110 aa AA seqDB search MRFNVMILLLGTSCICLALAQVSYDDCCLKYAKKMSGNAQKHAVKYRRQEPDGGCNIPAV VFTMRKGRVLCADPREKWVAALMTAIDKKEAKDYGNKHQRRHLRPRFHRG NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgcggttcaacgtgatgatcctcctgctgggcacgtcctgcatctgtctcgcactggca caagtgtcctatgacgactgctgtctgaagtatgcgaaaaaaatgagcggcaacgcccaa aagcacgcggtgaagtacaggcgacaggagcccgatggaggctgcaacatccctgctgta gtcttcaccatgaggaaggggcgcgtgctgtgcgcagaccccagagagaaatgggtcgca gcactgatgacggcgatcgacaaaaaggaggccaaagactatggcaacaaacaccaacgg aggcacctccgaccgcggttccaccgaggctga

DBGET integrated database retrieval system