Scophthalmus maximus (turbot): 118315055 Help Entry 118315055         CDS       T09850                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism smau  Scophthalmus maximus (turbot) Pathway smau04020   Calcium signaling pathway smau04070   Phosphatidylinositol signaling system smau04114   Oocyte meiosis smau04218   Cellular senescence smau04261   Adrenergic signaling in cardiomyocytes smau04270   Vascular smooth muscle contraction smau04371   Apelin signaling pathway smau04625   C-type lectin receptor signaling pathway smau04744   Phototransduction smau04910   Insulin signaling pathway smau04912   GnRH signaling pathway smau04916   Melanogenesis Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     118315055    04020 Calcium signaling pathway     118315055    04070 Phosphatidylinositol signaling system     118315055  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     118315055    04218 Cellular senescence     118315055  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118315055   09152 Endocrine system    04910 Insulin signaling pathway     118315055    04912 GnRH signaling pathway     118315055    04916 Melanogenesis     118315055   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     118315055    04270 Vascular smooth muscle contraction     118315055   09157 Sensory system    04744 Phototransduction     118315055  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:smau01009]     118315055   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smau04131]     118315055    03036 Chromosome and associated proteins [BR:smau03036]     118315055   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smau04147]     118315055 Protein phosphatases and associated proteins [BR:smau01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118315055 Membrane trafficking [BR:smau04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     118315055 Chromosome and associated proteins [BR:smau03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      118315055 Exosome [BR:smau04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118315055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 Motif Other DBs NCBI-GeneID:  118315055 NCBI-ProteinID:  XP_035497888 LinkDB All DBs Position 7:complement(26506941..26508166) Genome browser AA seq 81 aa AA seqDB search MHRQLQQEAPEQEILEAMKMADKEQKGFVLASELRAALTGVGEKLTDREVDELLREAGVG TDGRVHCEKFAKAVTRLSVRR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcaccggcagctccagcaggaggcgccggagcaggagatcctggaggccatgaagatg gcggacaaggagcagaagggcttcgtcctggcatcggagctgcgagccgcgctcaccggc gtgggcgagaaactgaccgaccgagaggtggacgagctgctgagggaggcgggcgtcggg acggacggtcgggttcactgcgagaagtttgctaaagcggtgacgcgcttgtctgtgagg cgctga

DBGET integrated database retrieval system