Scophthalmus maximus (turbot): 118315631 Help Entry 118315631         CDS       T09850                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism smau  Scophthalmus maximus (turbot) Pathway smau04068   FoxO signaling pathway smau04136   Autophagy - other smau04140   Autophagy - animal smau04621   NOD-like receptor signaling pathway smau04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     118315631 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118315631 (atg12)    04136 Autophagy - other     118315631 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118315631 (atg12)    04622 RIG-I-like receptor signaling pathway     118315631 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smau04131]     118315631 (atg12)    04121 Ubiquitin system [BR:smau04121]     118315631 (atg12)    03029 Mitochondrial biogenesis [BR:smau03029]     118315631 (atg12) Membrane trafficking [BR:smau04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     118315631 (atg12) Ubiquitin system [BR:smau04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    118315631 (atg12) Mitochondrial biogenesis [BR:smau03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     118315631 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Rotavirus_VP1 Motif Other DBs NCBI-GeneID:  118315631 NCBI-ProteinID:  XP_035498968 UniProt:  A0A2U9AXQ9 LinkDB All DBs Position 1:complement(13645818..13648654) Genome browser AA seq 117 aa AA seqDB search MSDNAESPTETPKEETQPPPDESTTNDEKKKIDVLLKAVGDTPIMKTKKWAVERVRTIQS LSQFIARFLKLDSSEQLFIYVNQSFAPSPDQEVGILFDCFGSDGKLVLHYCKSQAWG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtcggacaacgcagagtccccaacagaaacgccaaaagaggagacacagccaccgccg gacgagtcgacaacaaacgacgagaagaaaaaaatcgatgtgctgttgaaggcagtggga gacactcctataatgaaaacaaagaagtgggcagtagaacgggtgaggaccatacagtcc ctgtctcagttcatcgctcgtttcctcaagcttgattccagtgaacaactgttcatctat gttaatcagtcttttgcaccgtcaccggatcaagaagtagggatcctgtttgattgtttt ggtagcgatggcaagctggttctacattactgtaaatctcaagcctggggttaa

DBGET integrated database retrieval system