Scophthalmus maximus (turbot): 118315835 Help Entry 118315835         CDS       T09850                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism smau  Scophthalmus maximus (turbot) Brite KEGG Orthology (KO) [BR:smau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:smau03019]     118315835 (mt2)    03029 Mitochondrial biogenesis [BR:smau03029]     118315835 (mt2) Messenger RNA biogenesis [BR:smau03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      118315835 (mt2) Mitochondrial biogenesis [BR:smau03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     118315835 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  118315835 NCBI-ProteinID:  XP_035499326 LinkDB All DBs Position 7:complement(22608334..22609261) Genome browser AA seq 60 aa AA seqDB search MDPCDCSKTGTCNCGGSCTCTNCSCTTCKKSCCPCCPSGCTKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggacccctgcgactgctccaagactggaacctgcaactgcggtggatcctgcacctgc acaaactgctcctgcaccacctgcaagaagagctgctgcccatgctgcccatctggctgc accaagtgcgcctctggctgcgtgtgcaaggggaagacatgcgacaccagctgctgtcag tga

DBGET integrated database retrieval system