Scophthalmus maximus (turbot): 118319531 Help Entry 118319531         CDS       T09850                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism smau  Scophthalmus maximus (turbot) Pathway smau04010   MAPK signaling pathway smau04068   FoxO signaling pathway smau04081   Hormone signaling smau04114   Oocyte meiosis smau04140   Autophagy - animal smau04150   mTOR signaling pathway smau04810   Regulation of actin cytoskeleton smau04910   Insulin signaling pathway smau04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:smau00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118319531    04068 FoxO signaling pathway     118319531    04150 mTOR signaling pathway     118319531   09133 Signaling molecules and interaction    04081 Hormone signaling     118319531  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118319531   09143 Cell growth and death    04114 Oocyte meiosis     118319531   09142 Cell motility    04810 Regulation of actin cytoskeleton     118319531  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     118319531    04914 Progesterone-mediated oocyte maturation     118319531  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:smau04052]     118319531 Cytokines and neuropeptides [BR:smau04052]  Neuropeptides   Unclassified    118319531 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  118319531 NCBI-ProteinID:  XP_035505888 UniProt:  A0A2U9CBW3 LinkDB All DBs Position 9:8640079..8641536 Genome browser AA seq 112 aa AA seqDB search MARVPWAVSVTLLLVLYSQAAHSAAAAQHLCGSHLVDALYFVCGERGFFFSPNRPYKRDL EHLLGFLSERARQEQRLWRTRTGRNKLKVKRGIVEQCCHKPCSIYHLEGYCD NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatgggcggtgtccgtgacgctgctgctggtgctctactcccaggcg gcgcactccgccgccgccgctcagcatctgtgcggctcccacctggtggacgccctctac tttgtatgtggggaacgaggatttttcttcagtccaaaccgaccttacaagcgtgatctg gaacatctgctcgggttcctgtcagaaagggccaggcaggagcagcggctgtggaggact cggacgggccgcaacaagctcaaggtgaagcggggcatcgtggagcagtgctgccataaa ccatgcagcatttaccacctggagggctactgcgactga

DBGET integrated database retrieval system