Scophthalmus maximus (turbot): 8382080 Help Entry 8382080           CDS       T09850                                  Symbol ND4L, KEH04_p05 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism smau  Scophthalmus maximus (turbot) Pathway smau00190   Oxidative phosphorylation smau01100   Metabolic pathways Module smau_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:smau00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     8382080 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:smau03029]     8382080 (ND4L) Enzymes [BR:smau01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      8382080 (ND4L) Mitochondrial biogenesis [BR:smau03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     8382080 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  8382080 NCBI-ProteinID:  YP_003162767 UniProt:  C7S7B4 LinkDB All DBs Position MT:10327..10623 Genome browser AA seq 98 aa AA seqDB search MTPAHFAFSSAFLLGLAGLAFHRSHLLSALLCMEGMMLSLYVALSLWALQLDSAAFSASP LLLLAFSACEASIGLALLVAVARTHGTDRLQNLNVLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacccccgcccactttgctttctcatcagccttcttgttgggcctcgcgggattagcc tttcatcggtcccacctcttgtccgctctcctttgtatggagggtataatactttcgcta tatgttgccttatctctatgagcccttcagctagactccgcagccttctcagcctccccc ctccttttattagcgttttcagcctgtgaagcaagcattggcctagctttgctagtagcg gttgctcgaacccacggcacagaccgcctacaaaacctgaacgtcctgcaatgctaa

DBGET integrated database retrieval system