Shewanella marisflavi: CFF01_02095 Help Entry CFF01_02095       CDS       T05400                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism smav  Shewanella marisflavi Brite KEGG Orthology (KO) [BR:smav00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:smav03032]     CFF01_02095    03036 Chromosome and associated proteins [BR:smav03036]     CFF01_02095    03400 DNA repair and recombination proteins [BR:smav03400]     CFF01_02095 DNA replication proteins [BR:smav03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CFF01_02095 Chromosome and associated proteins [BR:smav03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CFF01_02095 DNA repair and recombination proteins [BR:smav03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CFF01_02095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg HU-CCDC81_bac_2 HU-CCDC81_euk_1 NA37 Motif Other DBs NCBI-ProteinID:  ASJ95473 UniProt:  A0AAC9TWX4 LinkDB All DBs Position complement(456052..456324) Genome browser AA seq 90 aa AA seqDB search MNKTELVAKIAESAELTKAEAARALKSFEETVAEAMKNGEKISIVGFGSFETTSRAARTG RNPQTGKEIQIPAAIVPKFKAGKTLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaactgaacttgttgcaaaaatagcggaaagcgctgaacttactaaagctgaa gctgctcgcgccttaaaatctttcgaagaaacggtagcggaagcgatgaagaacggcgaa aaaatctctattgtaggttttggctctttcgagaccactagccgcgcagcacgtacaggc cgcaacccacagacgggcaaagaaattcagatcccagcggccatagtacctaagtttaaa gccggtaagacgttaaaagacagcgtaaactaa

DBGET integrated database retrieval system