Shewanella marisflavi: CFF01_17260 Help Entry CFF01_17260       CDS       T05400                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smav  Shewanella marisflavi Pathway smav01100   Metabolic pathways smav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smav00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFF01_17260    00074 Mycolic acid biosynthesis     CFF01_17260   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFF01_17260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASJ98196 UniProt:  A0AAC9XPM0 LinkDB All DBs Position 3922075..3922329 Genome browser AA seq 84 aa AA seqDB search MSLQNEIKQLIIDCLDLEDVSIDDIETDAPLFGDGLGLDSIDALELGLAIKKQFDVKIEA NSEATKAHFYSVASLASFIESQRG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttacaaaacgaaattaaacaactcatcatagattgcctcgatctagaagatgtc agcatcgacgatattgaaaccgatgcacccctctttggtgacggtttagggctagattct atcgatgcgcttgagctgggcttggcaattaagaaacagttcgatgtcaaaatcgaagcc aactcagaagccaccaaggctcacttctatagcgttgccagtctggcaagctttatcgaa tctcaacgcggttag

DBGET integrated database retrieval system